KEGG   Alkalihalobacillus krulwichiae: BkAM31D_02760
Entry
BkAM31D_02760     CDS       T04947                                 
Symbol
bioI
Name
(GenBank) Biotin biosynthesis cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bkw  Alkalihalobacillus krulwichiae
Pathway
bkw00780  Biotin metabolism
bkw01100  Metabolic pathways
bkw01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bkw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BkAM31D_02760 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bkw00199]
    BkAM31D_02760 (bioI)
Enzymes [BR:bkw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     BkAM31D_02760 (bioI)
Cytochrome P450 [BR:bkw00199]
 Cytochrome P450, bacteria type
  CYP107 family
   BkAM31D_02760 (bioI)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: ARK28862
UniProt: A0A1X9MEJ7
LinkDB
Position
476011..477186
AA seq 391 aa
MKTEFEDLTQNPYPFYEEIRAQSPIHWGEFFGNRGWYITGYEEASMILKDLRFQNRMPLP
ETTKWFERLKEIQKQMVLYQNPPDHRKIRRLVNERFTPKVLERYVFMIEETAEQLFSHIK
NDKKLDFIADFAFPLASTVIARLLGVPERDKDLFRRWALTLIDTIDLNRSRKSLVKGNEC
IVEMVHYFKSLILNSKRNRKNDLISVLVEEQNNDKLTEDEVLSTCILLLIAGHETTVNLI
SNAIYCLATNQEQQIKLREEPLLLKTAIEEVLRYESPTQLTARIASTDVIINQTQIKKGD
HIYLFLGACNRDPKNFPNANTLDFAREPNPHLSFGAGIHFCLGSELAKIETKAALRTILK
NTNSIQIDSKQLEWRNLTGFRALKELPVVFN
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgaaaacagagttcgaggatttaacgcaaaacccgtatcctttttatgaagaaattcgt
gctcagtcacctatacactggggagagtttttcgggaaccgtggctggtacataacaggt
tatgaagaagcaagcatgatcttgaaagatcttcgttttcaaaatcgcatgccgcttcca
gaaacaacaaagtggttcgaacgtttaaaagagatccagaaacagatggtactttatcaa
aatccgcctgaccataggaagatacgtagactggtaaatgaaagatttactcctaaggta
ctagaacggtacgtgtttatgattgaagaaacagctgaacaattattttcacatataaaa
aatgataagaagctcgactttattgctgactttgcttttccgctagcaagcacagtgata
gctagacttttaggcgttccggaaagagataaagatctattcagaaggtgggcattaacg
ttaattgatacgattgatctcaaccgttctagaaaatcattagtgaaggggaatgaatgc
attgtagagatggttcattattttaaaagtttgatcctaaatagtaaacgaaatcgaaaa
aatgatctcattagtgtgttggtagaggagcagaacaatgataagttaacagaggatgag
gtcctatcaacttgtattcttttactaatagccggtcacgaaacaacagtgaatttaatt
agtaatgcgatttactgtttggcaactaatcaagagcaacaaataaaattaagagaagaa
cctctcctactaaaaacggcaattgaagaggtgttacgttatgagagtccgactcaatta
acggctcgtatcgcttcaacagatgtgatcattaatcaaacacaaattaaaaaaggtgat
catatctatctttttcttggtgcttgtaatcgtgatcccaaaaatttcccgaatgcgaat
actttggattttgcgagggagcctaatcctcatctttcatttggggcaggaattcatttt
tgtttaggctcggaattggcaaaaatagaaacaaaagcagctcttcgtactattttaaag
aatacaaactcaatacaaattgattcaaaacaactggagtggagaaatcttacgggattt
agagcattgaaagaattgccagtggtgtttaattaa

DBGET integrated database retrieval system