KEGG   Alkalihalobacillus krulwichiae: BkAM31D_17535
Entry
BkAM31D_17535     CDS       T04947                                 
Name
(GenBank) Purine-binding protein precursor
  KO
K05519  transcriptional activator of comK gene
Organism
bkw  Alkalihalobacillus krulwichiae
Brite
KEGG Orthology (KO) [BR:bkw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bkw03000]
    BkAM31D_17535
Transcription factors [BR:bkw03000]
 Prokaryotic type
  Other transcription factors
   Others
    BkAM31D_17535
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: ARK31496
UniProt: A0A1X9MDK9
LinkDB
Position
complement(3180686..3181645)
AA seq 319 aa
MFIQRILLLLVPVILLIGCASPNASNGNRVGLLLEDTIDDQGWNSKGYQGLLNIHSNLNV
EVMFKEDMNTEPKVKNAIEDFVKEEVELVFGHGRYYADLFTEIAPLYPDVHFVSFNGEVE
GDNVTSLHFDSYAMGYFAGMIAAAMSETGHIGAIATFPWQPEVQGFEAGAALYGRNDSSV
HIEYVHDWFDSELASSYFEQLKSEGVDVFYPAGDGFHVSVIEEARNEGLYAIGYVGDQSD
LGESTVLTSTVQHVDYLYELIAEKYFNSELEKGNLRFDFDDGVITLGNFSSKVPEEFQIK
IGNAVKSYIETGELPQEPI
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtttattcaacggattttattgttactagtgccagtaatactattaataggctgtgcc
agtccgaatgctagtaatggaaatagagtaggattattactcgaagatacaattgatgac
caggggtggaatagtaaaggatatcaagggttgctaaacattcattcaaatttaaatgta
gaagtgatgtttaaagaagatatgaacacagaaccaaaagtgaaaaatgcgatagaagac
tttgtcaaggaagaagtagagcttgtttttggacatggtcgttattacgctgatttattt
acagaaattgcacctttatatcctgatgttcattttgtcagttttaacggagaagttgaa
ggagacaatgtcacaagtcttcattttgatagttatgcaatgggttatttcgcaggaatg
attgccgcggcaatgtctgaaacaggacatattggagcaattgcaacatttccatggcaa
cctgaagtacaaggttttgaagcaggtgcagcactatatggaagaaatgactccagtgtc
cacattgaatatgtacatgactggtttgacagtgaacttgcttcttcatattttgagcaa
ttaaaaagtgaaggcgtcgatgtattctatcccgctggtgatgggtttcatgtcagtgta
attgaagaagctagaaatgaaggattatatgcaattggttatgttggtgatcaatctgat
ttaggggaatcaacggttctaacgagcacggtccagcatgtcgattatttatatgaatta
attgccgagaaatattttaatagcgaactagaaaaaggaaatttgcgatttgactttgat
gacggtgtgattacgttaggaaactttagttcgaaagtgccagaggaatttcagataaag
ataggaaatgctgtaaaatcttatattgaaacaggagagcttccacaagaacctatataa

DBGET integrated database retrieval system