Burkholderia latens: WK25_23435 Help Entry WK25_23435        CDS       T04819                                  Name (GenBank) H-NS histone   KO K03746   DNA-binding protein H-NS Organism blat  Burkholderia latens Brite KEGG Orthology (KO) [BR:blat00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:blat03036]     WK25_23435    03400 DNA repair and recombination proteins [BR:blat03400]     WK25_23435 Chromosome and associated proteins [BR:blat03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     WK25_23435 DNA repair and recombination proteins [BR:blat03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       WK25_23435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Nnf1 CC_BshC LemA YL1_C Motif Other DBs NCBI-ProteinID:  AOK07453 UniProt:  A0AAP1C4H0 LinkDB All DBs Position 2:complement(912033..912320) Genome browser AA seq 95 aa AA seqDB search MQLQKLQAQLAELDQRIRAARRRERNAALAQVRQIVTNYALTAREIFGQGYSDRAKLFTA GAKYRDPATGATWSGRGRAPAWIAGRDRTAFLIRD NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgcaactgcagaaactgcaagcccagctcgcggaactcgatcaacgcatccgcgcggcg cgccgccgcgaacgtaacgcggcactggcacaagtccgccagatcgtcacgaactacgca ctcactgcccgcgaaatcttcggccagggttacagcgatcgcgcgaaactgttcacggcc ggcgcgaagtaccgcgatccggccacgggcgctacgtggagcgggcgcggccgcgcccct gcatggatcgccgggcgcgatcgcaccgccttcctgatccgggattga

DBGET integrated database retrieval system