KEGG   Bifidobacterium lemurum: BL8807_06640
Entry
BL8807_06640      CDS       T06861                                 

Name
(GenBank) aminoglycoside phosphotransferase family protein
  KO
K13059  N-acetylhexosamine 1-kinase [EC:2.7.1.162]
Organism
blem  Bifidobacterium lemurum
Brite
KEGG Orthology (KO) [BR:blem00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BL8807_06640
Enzymes [BR:blem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.162  N-acetylhexosamine 1-kinase
     BL8807_06640
SSDB
Motif
Pfam: APH Choline_kinase
Other DBs
NCBI-ProteinID: QOL33486
UniProt: A0A261FVG2
LinkDB
Position
1748992..1750071
AA seq 359 aa
MAQHDAHLDAVVENFPLEGTVESIAPYGDGHINTTYLVTTGVRRYILQRMNTDIFPDTAN
LMRNIELVTDFLRSQGQETLDIIRTSDGASYYEAPDGPYRVFVFIENTISYNLVPDADVF
RDAGAAFGQFQNQLARFDASQLTETIANFHNTPSRFRDFQAAVEADSMGRAAGCRDEIDF
FMNHADEYSVIMDGLADGSIPLRVTHNDTKLNNILMDADTHKARAIIDLDTVMPGSMLFD
FGDSIRFGASTALEDEKDLDKVHFSTELFRAYAQGFVGELRDSITAREAELLPMGGKMMT
MECGMRFLADYLVGDTYFATKYPEHNLVRARTQIKLVQEMEQKAGETDAIVDEIMNEAR
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggctcagcatgacgcccacctcgacgcggtcgtcgagaacttccccctcgagggaacc
gtcgaaagcatcgccccctacggcgacggccacatcaacaccacctacctggtcacgacc
ggcgtccgccggtacatcctgcagaggatgaacaccgacatcttccccgacacggcgaac
ctgatgcgcaacatcgagctcgtcaccgacttcctgcgctcgcagggccaggagacgctg
gacatcatccgcaccagcgacggcgcctcctactatgaggccccggacggcccgtaccgc
gtgttcgtgttcatcgagaacaccatctcgtacaacctcgtgcccgacgcggacgtgttc
cgcgacgccggcgcggcgttcggccagttccagaaccagctggcgcgcttcgacgcctcg
cagctgaccgagaccatcgccaacttccacaacaccccgagccgtttccgcgacttccag
gccgcggtggaggcggactcgatgggccgcgccgccggctgccgcgacgagatcgacttc
ttcatgaaccacgccgacgaatactcggtgatcatggacggtctggcggacggctcgatc
ccgctgcgcgtgacgcataacgacaccaagctcaacaacatcctgatggacgcggacacg
cacaaggcgcgcgccatcatcgacctcgacaccgtgatgccgggctccatgctgttcgac
ttcggcgactccatccgcttcggcgcctccacggcgctcgaggacgagaaggacctcgac
aaggtgcatttcagcaccgagctgttccgcgcgtacgcgcaaggattcgtgggcgagctg
cgcgacagcatcaccgcgcgcgaggccgagctgctgccgatgggcggcaagatgatgacc
atggaatgcggcatgcgcttcctggccgactatctcgtgggcgacacctatttcgccacc
aagtatcccgagcacaatctggtccgcgcccgcacgcagatcaaactcgtgcaggagatg
gagcagaaggccggcgaaaccgacgccatcgtcgacgagatcatgaacgaggcgcgctga

DBGET integrated database retrieval system