KEGG   Bacillus paralicheniformis: BaLi_c08690
Entry
BaLi_c08690       CDS       T02694                                 
Symbol
bioI
Name
(GenBank) biotin biosynthesis cytochrome P450 enzyme BioI
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
blh  Bacillus paralicheniformis
Pathway
blh00780  Biotin metabolism
blh01100  Metabolic pathways
blh01240  Biosynthesis of cofactors
Module
blh_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:blh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BaLi_c08690 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:blh00199]
    BaLi_c08690 (bioI)
Enzymes [BR:blh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     BaLi_c08690 (bioI)
Cytochrome P450 [BR:blh00199]
 Cytochrome P450, bacteria type
  CYP107 family
   BaLi_c08690 (bioI)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AGN35264
LinkDB
Position
861387..862583
AA seq 398 aa
MTTELHEAGPRLKSDSDFWRDPYLFYDKLRSVHPVYKGTVLKHLGWYVTGYEEAAAILRD
AVFKNRVPLPEASTKYEQLHELQRNMMLFQNESGHKRMRTIVGKEFMPQKTASFRPVIEE
IVHELLDQLENKKMADMVSEFAFPLASLIIADMLGVPAEERYQFRQWTADLIQTIDLTRT
RKVLAKGGDTVAKLTAYFKDLIEKRKAHPSQDLISTFAGHEQLAEDEVLATCILLVIAGH
ETTVNLLTNGLFLLMNHPGQLSALKENPLLIESAVEECLRYESPTQLTARTASEDCEING
KIIKKGEHVYILLGAANRDPKIFQNPHVFDITRKPNPHLAFGAGAHVCLGSALARLEAQI
AIPALLERLPKLKLASTDIPFRRLIGFRSLAELPVILN
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgacgacagaactgcacgaggcagggccgcgtctgaaatcggattcggatttttggaga
gatccatatctgttttacgataaactgcggtccgttcatcctgtatataaaggaaccgtt
ttaaagcatctgggatggtatgtcaccggatatgaagaagcggcggcgattttgagggac
gcggtatttaaaaaccgcgttcctctccctgaagcctctacaaaatatgaacaacttcac
gaattgcagcggaatatgatgctgtttcaaaatgagtctggccataagcggatgcggacg
attgtcggcaaagaattcatgccgcagaagacggcatctttccgtcctgttatagaagaa
atcgtccatgaattgctcgatcagcttgaaaacaagaagatggcggacatggtatccgaa
ttcgcctttcctttggcaagccttatcattgccgacatgctcggcgtccccgcagaggag
agatatcaattcaggcaatggacggcggatctcattcaaacgatcgatttgacccgcaca
cgaaaggtgctggcaaaaggcggggataccgttgccaagctgacggcgtattttaaagat
ttgattgaaaagcgaaaagctcatccttctcaagacctgatcagcacattcgccggtcat
gagcagctcgccgaagatgaagttcttgcgacgtgcattctgcttgtgattgccgggcac
gagacgacggtcaaccttttgacgaacggattgtttttgctcatgaaccatcccggccag
ctcagcgcgctgaaagaaaatccgctgctgattgagtcagccgttgaagaatgcctgcgc
tatgaaagtccgacacagctgacagcgcgcaccgcgtcagaggactgtgaaatcaacggg
aagatcatcaaaaaaggagagcacgtatacatccttttaggcgccgccaaccgcgatccg
aagatatttcaaaatccgcatgtatttgacatcacgagaaaaccgaatccgcaccttgcc
tttggagccggtgcacacgtatgtttaggctcggcattggcgcggctcgaagcgcaaatt
gccattcccgcattgttggagcggctgcctaagttgaagcttgcttcaacagacattcca
tttcgcaggttaatcggctttagatcgctggccgagctgcctgtcattctcaattaa

DBGET integrated database retrieval system