KEGG   Bacillus licheniformis ATCC 14580: BL00957
Entry
BL00957           CDS       T00197                                 
Symbol
bioI
Name
(GenBank) cytochrome P450 enzyme
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00780  Biotin metabolism
bli01100  Metabolic pathways
bli01240  Biosynthesis of cofactors
Module
bli_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bli00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BL00957 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bli00199]
    BL00957 (bioI)
Enzymes [BR:bli01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     BL00957 (bioI)
Cytochrome P450 [BR:bli00199]
 Cytochrome P450, bacteria type
  CYP107 family
   BL00957 (bioI)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AAU22357
UniProt: Q65MK8
LinkDB
Position
782727..783923
AA seq 398 aa
MTTELHEAGPSLKSDSDFWRDPYLFYDQLRSIHPVYKGTVLKHPGWYVTGYEEAAAILKE
PAFINRVPLPEASTKYEQLQRLQRNMMLFQNESGHKRMRTIAGKEFMPQKTATFRPAIEE
TVHELLDQLENKKTADMVSEFAFPLASLIIAGMLGVPEEEWYQFRQWTADLIQTIDLTRT
RKVMAKGGDTVAKLTAYFKNLIEKRKAHPSEDLISTFAGHEQLADEEVLATCILLVIAGH
ETTVNLLTNGLFLLMTHPDQLSELKENPLLIESAVEECLRYESPTQLTARTASEDCEING
KIIKKGEHLYILLGAANRDPKIFQNPHLFDITRKPNPHLAFGAGAHVCLGSALARLEAQI
AIPALLARLPNLKLASTDVPFRRLIGFRSLAELPVILN
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgacgacagaactgcacgaggcagggccgagcctgaaatcggattcggatttttggaga
gatccatatctgttttacgatcagctgcggtccattcatcctgtatataaaggaaccgtt
ttaaagcatccgggctggtatgtcaccggatatgaagaagcggcagcgattttgaaggaa
ccggcatttataaaccgcgttcctctcccagaagcttctactaaatatgaacaacttcag
cgattgcagcgaaatatgatgctgtttcaaaatgagtccggccataagcggatgcggacg
attgccggcaaagaattcatgccgcagaagacggcaactttccgccctgctatagaagaa
accgtccatgaattgctcgatcagcttgaaaacaagaagacggcggacatggtatcggaa
ttcgcctttcctttggcaagccttatcattgccggcatgctcggcgtcccggaagaggaa
tggtaccaattcaggcaatggacggcggatctcattcaaacgatcgatttgacccgtaca
cgaaaggtaatggcaaaaggcggtgataccgttgccaagctgacggcttattttaaaaat
ttaattgaaaagcgaaaagcgcatccttctgaagacctgatcagcacattcgccggtcat
gagcagcttgctgatgaagaagtgcttgcgacgtgcatcctgcttgtgattgccggacat
gagacgacagtcaaccttttgacgaacgggttgtttttgctcatgacacatcctgaccag
ctcagtgagctgaaagaaaatccgctgctgattgagtcggccgtcgaagaatgtcttcgc
tatgaaagcccgacacagctgacagcgcgcaccgcgtcggaggactgcgaaatcaacggg
aaaatcatcaaaaaaggagagcacttatatatccttttaggcgccgccaaccgcgatcca
aagatatttcaaaacccgcatctatttgacatcacaagaaagccgaatccgcaccttgcc
tttggagccggtgcgcacgtatgtttaggctcggcattggcgcggctcgaagcgcaaatt
gccattcccgcactgttggcgcggctgcctaacttgaagcttgcttcaacagacgttcca
tttcgcaggctaatcggctttagatcgctggccgagctgcctgtcatcctcaattaa

DBGET integrated database retrieval system