Blautia liquoris: INP51_00170 Help Entry INP51_00170       CDS       T07726                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bliq  Blautia liquoris Pathway bliq01100   Metabolic pathways bliq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bliq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     INP51_00170   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     INP51_00170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  QOV19437 UniProt:  A0A7M2RIS0 LinkDB All DBs Position 30022..30246 Genome browser AA seq 74 aa AA seqDB search MLEKIKEIVADSLGVEVDTLKSETSFKDDLGADSLDLFELVMALEEEFNVEIPTDDLEKI QTIGDIETYIQKLQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgttagaaaaaattaaagaaattgttgcagattcattaggtgtggaagttgatacttta aaatcggaaacttcttttaaggatgatcttggcgcggactcacttgatttgttcgaactt gtgatggctttggaggaagagtttaatgtggaaattccaacggatgatctggagaaaatt cagacaattggtgatattgagacttacattcagaaactgcagtaa

DBGET integrated database retrieval system