Burkholderia mallei ATCC 23344: BMA0864 Help Entry BMA0864           CDS       T00204                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bma  Burkholderia mallei ATCC 23344 Brite KEGG Orthology (KO) [BR:bma00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bma03036]     BMA0864    03400 DNA repair and recombination proteins [BR:bma03400]     BMA0864 Chromosome and associated proteins [BR:bma03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BMA0864 DNA repair and recombination proteins [BR:bma03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BMA0864 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AAU49114 UniProt:  A0A0H2WJK6 LinkDB All DBs Position 1:complement(902441..902722) Genome browser AA seq 93 aa AA seqDB search METYLDLLAEREALMIKLDAARMQARSAALSEVKRIVEEFELTTQEVFGRAGVLRRRGKL KPKYRDPKTGATWNGRGRPPSWIAGKDRAAFVA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaaacctacctcgaccttctggccgaacgagaagccctgatgatcaagctggatgcg gcgcgcatgcaggcgcgcagcgccgcgctatccgaagtgaagcgaatcgtcgaggaattc gaactcacgacgcaggaagtgttcggccgcgcgggcgtgctgcgccgtcgcggcaagctc aagccgaagtatcgcgatccgaaaaccggcgcgacctggaacggccgcggccgcccgcct tcgtggatcgccggaaaggatcgcgccgcgttcgtcgcttga

DBGET integrated database retrieval system