KEGG   Priestia megaterium DSM 319: BMD_0302
Entry
BMD_0302          CDS       T01219                                 
Symbol
med
Name
(GenBank) regulator of comK competence gene
  KO
K05519  transcriptional activator of comK gene
Organism
bmd  Priestia megaterium DSM 319
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bmd03000]
    BMD_0302 (med)
Transcription factors [BR:bmd03000]
 Prokaryotic type
  Other transcription factors
   Others
    BMD_0302 (med)
SSDB
Motif
Pfam: Bmp Phage_cap_E Arch_flagellin CoA_binding_2
Other DBs
NCBI-ProteinID: ADF37213
UniProt: D5D9F1
LinkDB
Position
277197..278180
AA seq 327 aa
MQRSRQLRLILLLALIVVASFLIIIISKTHGIISQQTTKKVENTSVAILTSDVLTDQSWG
SLAYKGKINIEQQYPVSAQVISEVNTNQKMKEAAEKVIQNGTKVVIGHGREFSTVFTELA
PKYPHVHFVTIHGTSMYKNQTVYTFDQTKIEHLAGMAAAMKTKTKKIGLLDTFVKEKNPG
FEQGIKAYDSSIAFYYRVVNSRDDGAKAVKLLRELKDQGVDIVYAKGNSYNQEVIQEAKT
QGMYVIGYLDDQAYMGRSVILTSVINDVPQAYNVIMKDYFSKKGLPSGEVKLDARDGVYK
LAPFGPMYSKREKQILYSKVRMSTQPK
NT seq 984 nt   +upstreamnt  +downstreamnt
atgcaacgatcaagacagttaaggctgattttattgcttgctctgattgttgtcgcttcg
tttttaattattattatttcgaaaacacatgggattataagtcagcaaacgacaaaaaaa
gtagaaaacacaagcgttgcaattctcacctctgatgtactgacggatcaaagctggggc
agtctagcttataaaggaaaaatcaacattgagcagcagtatcctgtttcggctcaagtt
attagcgaagtaaatacgaaccaaaaaatgaaggaagctgctgaaaaagttattcaaaat
ggaacaaaagtcgtaattggacatggaagagaattttctaccgtttttacagaactagct
cctaagtatcctcatgttcatttcgtcaccattcacggtacttcaatgtataaaaaccaa
actgtatatacatttgatcaaacaaaaatagagcacctggcaggcatggcagctgccatg
aagacaaaaacgaaaaaaattggattactcgatacatttgtaaaagaaaaaaatccagga
tttgaacaaggaatcaaagcgtatgattcatcgattgctttttattatcgagttgtaaac
agccgagacgatggagcaaaagcagtaaagctgctccgtgagttaaaagatcaaggtgtt
gatatcgtctatgctaaaggaaattcgtataatcaagaagttattcaagaagcgaaaaca
caaggaatgtacgtaataggatatttagatgatcaggcgtacatgggtaggtctgttatt
ttaaccagcgtgatcaacgatgttcctcaagcttacaacgtgattatgaaagactatttc
agtaaaaaaggtcttccatctggagaagtcaaacttgacgccagggatggtgtttataaa
ctagcgccttttggaccgatgtacagtaaacgagaaaaacaaattttatattcgaaagtt
agaatgtctacacagccgaagtaa

DBGET integrated database retrieval system