KEGG   Bacillus megaterium WSH-002: BMWSH_4929
Entry
BMWSH_4929        CDS       T01890                                 
Symbol
med
Name
(GenBank) Positive regulator of comK
  KO
K05519  transcriptional activator of comK gene
Organism
bmh  Bacillus megaterium WSH-002
Brite
KEGG Orthology (KO) [BR:bmh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bmh03000]
    BMWSH_4929 (med)
Transcription factors [BR:bmh03000]
 Prokaryotic type
  Other transcription factors
   Others
    BMWSH_4929 (med)
SSDB
Motif
Pfam: Bmp Phage_cap_E Hydrolase_3 Arch_flagellin
Other DBs
NCBI-ProteinID: AEN91807
UniProt: A0A8D3X3B9
LinkDB
Position
complement(4698669..4699655)
AA seq 328 aa
MQRSRQLRLILLLALIVIASFLIIIISKTQGIISQQTTKKVENTSVAILTSDVLTDQSWG
SLAYKGKINIEQQYPVSAQVISEVNTNQKMKEAAEKVIKNGTKVVIGHGREFSTVFTELA
PKYPHVHFVTIHGTSTYKNQTVYTFDQTKIEYLAGTAAAMKTKTKKIGLIDAFEAREKNP
GFEKGIKASDSSIAFYYRVANSRDDGVKAVKLLRELKDEGVDIVYAKGNSYNQEVIQEAK
VQGMYVIGYLDDQAYMGRSVILTSVINDVPQAYNVIMKDYFSKTGLPTGEVKLDARDGVY
KLAPFGPMYSKGEKQILYSKVRMSTQPK
NT seq 987 nt   +upstreamnt  +downstreamnt
atgcaacgatcaagacagttaaggctgattttattgcttgccctgattgttatcgcttcg
tttttaattattattatttcgaaaacacaagggattataagtcagcaaacgacaaaaaaa
gtagaaaacacaagcgttgcaattctcacctctgatgtactgacggatcaaagctggggc
agtctagcttataaaggaaaaatcaacatcgagcagcagtatcctgtttcagctcaagtt
attagcgaagtaaatacgaaccaaaaaatgaaggaagcagctgaaaaagttattaaaaat
ggaacaaaagtcgtaattggacatggaagagaattttctaccgtttttacagaacttgct
cctaagtatcctcatgttcatttcgtcaccattcacggtacttcaacttataaaaaccaa
acggtatatacatttgatcaaacaaaaatagagtatctggcaggtacggcagctgccatg
aagacaaaaacgaaaaaaattggattaattgatgcatttgaagcgcgcgaaaaaaatcca
gggtttgaaaaaggcataaaagcgtctgattcctcaattgctttttattatcgagttgca
aacagccgagacgatggagtaaaagcagtaaagctgctccgtgagttaaaagatgaaggc
gtcgatatcgtctatgctaaaggaaattcatataatcaagaagttattcaagaagcgaaa
gtacaaggaatgtacgtaataggatatttagatgatcaggcgtacatgggtaggtctgtt
attttaaccagtgtgatcaatgatgttcctcaagcttacaacgtgattatgaaagactat
tttagtaaaacaggtcttccaactggagaagttaaacttgacgccagggacggtgtttat
aaactagcgccttttggaccgatgtacagtaaaggggaaaaacaaattttatattcgaaa
gttagaatgtctactcagccgaagtaa

DBGET integrated database retrieval system