Burkholderia mallei NCTC 10229: BMA10229_1470 Help Entry BMA10229_1470     CDS       T00471                                  Name (GenBank) gluconolactonase precursor   KO K01053   gluconolactonase [EC:3.1.1.17] Organism bml  Burkholderia mallei NCTC 10229 Pathway bml00030   Pentose phosphate pathway bml00053   Ascorbate and aldarate metabolism bml00930   Caprolactam degradation bml01100   Metabolic pathways bml01110   Biosynthesis of secondary metabolites bml01120   Microbial metabolism in diverse environments bml01200   Carbon metabolism bml01220   Degradation of aromatic compounds bml01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:bml00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     BMA10229_1470    00053 Ascorbate and aldarate metabolism     BMA10229_1470   09111 Xenobiotics biodegradation and metabolism    00930 Caprolactam degradation     BMA10229_1470  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bml04147]     BMA10229_1470 Enzymes [BR:bml01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.1  Carboxylic-ester hydrolases     3.1.1.17  gluconolactonase      BMA10229_1470 Exosome [BR:bml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    BMA10229_1470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SGL Motif Other DBs NCBI-ProteinID:  ABN00351 UniProt:  A2S003 LinkDB All DBs Position II:1531041..1531436 Genome browser AA seq 131 aa AA seqDB search MSAMSEIGSRRYPDPAVRVLDPRFGALRLPSASVECLFQGARWSEGPVWFGDGRYLLWSD IPNNRMLRWDEQSGTVGVFRQPSNNANGNTRDRAGRLVTCEHLTRRVTRTEYDGSITVLA ERFAGKRFNSP NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgatgagcgagatcggctcacggcgttatcccgaccccgcggtgcgcgtgctc gatccgcgcttcggcgcgctgcggctgccgtcggcgtccgtcgaatgtctgtttcaaggc gcgcgatggtccgaaggcccggtgtggttcggcgacggccgctatctgctgtggagcgac atcccgaacaaccggatgctgcggtgggacgaacagagcggcacggtcggcgtgtttcgc cagccgtcgaacaacgcgaacggcaacacgcgcgaccgcgcggggcggctcgtgacctgc gaacacttgacgcgccgcgtcacgcgcaccgaatacgacggttcgatcaccgtgctcgcc gagcggttcgccggcaagcgtttcaattcgccgtga

DBGET integrated database retrieval system