KEGG   Bacillus mojavensis: HC660_28830
Entry
HC660_28830       CDS       T07122                                 
Symbol
bioI
Name
(GenBank) Putative cytochrome P450 hydroxylase, biotin biosynthesis cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bmoj  Bacillus mojavensis
Pathway
bmoj00780  Biotin metabolism
bmoj01100  Metabolic pathways
bmoj01240  Biosynthesis of cofactors
Module
bmoj_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bmoj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HC660_28830 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bmoj00199]
    HC660_28830 (bioI)
Enzymes [BR:bmoj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     HC660_28830 (bioI)
Cytochrome P450 [BR:bmoj00199]
 Cytochrome P450, bacteria type
  CYP107 family
   HC660_28830 (bioI)
SSDB
Motif
Pfam: p450 Cas_Cas5d
Other DBs
NCBI-ProteinID: QJC97356
UniProt: A0A6H2JTW8
LinkDB
Position
complement(2883494..2884678)
AA seq 394 aa
MTIPISLTPSAFFKNPYPYYDTLRSAHPLYKGNVLKYPGWYVTGYEEAAAILKDTRFKTR
VPLPETSMKYKDLNHVQKQMMLFQNQPDHRRLRLPVSGVFTPRMTECYRPFINETVHHLL
DQVQGEKKMELISDFAFPLASCIIAKIIGVPAEERDQCKEWASSLVQTIDLTRSRKVLTD
GNQITAKMKEYFRELIQKRKQNPQHDVISMLLKEEQADKLTEEEVASTCILLAIAGHETT
VNLISNSILCLLQHREQLLQLKENPALIHTAVEECLRYESPTQMTARVASEEIDMNGVTI
RQGEQVYVLLGAANRDPKVFAHANEFDITRSPNPHLSFGQGHHICIGSSLARLEAQIAIN
TLLQRMPSLQLAVSEVRYRKLIGFRALMELPVTF
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgacaattccaatttcacttacaccttctgcgttttttaaaaacccttatccttattac
gacacattacgttctgcacaccctttatataaagggaatgttttaaagtatccaggctgg
tatgtcacgggatatgaggaagcggcagcaattctgaaagataccagattcaaaacacgt
gtcccgctgcccgagacgtctatgaaatataaggatctaaatcatgtccagaagcagatg
atgctgtttcagaatcagcctgatcataggcgtctgcgtctaccggtcagcggggtattt
actccgagaatgacagagtgctatcgcccatttataaatgaaactgtccatcatttgctt
gatcaagtgcaaggtgaaaaaaagatggagctgatttctgactttgcttttcctttggca
agctgcattatagctaagatcataggtgtgccggcagaagaaagggatcaatgtaaagag
tgggcgtcaagcctcgttcaaacaattgatctaacccgatcaagaaaggtgttaacagac
ggcaatcagattacagcaaagatgaaggagtattttagagagctcattcaaaagcggaaa
caaaatccgcagcatgatgtgatcagcatgctgctgaaggaagaacaggctgataagctg
acggaagaggaagtggcatcaacgtgtatattgctggcgatcgccggacatgaaacaaca
gtgaatctcatcagcaactcaattctttgtctgctgcagcatcgagaacagcttttgcag
ctcaaagaaaacccagctctgattcataccgcagttgaggaatgcttacgctatgaaagc
cccacacaaatgacagctcgtgttgcgtcagaagagattgatatgaatggcgtaacgatt
cgtcaaggggagcaagtctatgttctgctgggggctgccaatcgagatccaaaagtattc
gcgcatgccaatgagttcgatatcaccagaagccctaatccccatctttcattcgggcag
ggccaccatatttgtataggttcttcgctggcacggttagaagcacaaattgcaatcaac
actcttctgcagcgcatgccaagcctgcagctcgctgtttctgaagtgcggtaccggaag
ctaattggttttagagcgcttatggagctgccagttactttttaa

DBGET integrated database retrieval system