KEGG   Bombyx mori (domestic silkworm): 100127116
Entry
100127116         CDS       T02817                                 
Symbol
Cyp306a1
Name
(RefSeq) cytochrome P450 monooxygenase
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    100127116 (Cyp306a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bmor00199]
    100127116 (Cyp306a1)
Enzymes [BR:bmor01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     100127116 (Cyp306a1)
Cytochrome P450 [BR:bmor00199]
 Cytochrome P450, animal type
  CYP306 family
   100127116 (Cyp306a1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100127116
NCBI-ProteinID: NP_001106222
UniProt: Q6I6X0
LinkDB
Position
10:10220241..10227656
AA seq 538 aa
MDLYFIWLVTFVAGFWIFKKIKEWQNLPPGPWGLPIVGYLPFIDRYHPHITLTNLSKTYG
AIYGLKMGSIYAVVLSDHKLVGDTFSKDSFSGRAPLYLTHGLMNGNGIICAEGGLWRDQR
KLITSWLKSFGMSKHSVSREKLEKRIASGVYEILENIEKTSDAALDLPHMLTNSLGNVVN
EIIFGFKFPPEDKTWQWFRQIQEEGCHEMGVAGVVNFLPFIRHVSPSTRKTIEVLVRGQA
QTHTLYASMIDRRRKMLGLEKPKGAEYAPHENLLKLYPNGHIKCIKYSKVSPNTEHFFDP
NTLIPTEGDCILDNFLLEQKKRFESGDPTALYMRDEQLHFLLADMFGAGLDTTSVTLAWF
LLYMALFPEEQEEIRKEILSVYPYDDDVDSSRLPLLMAAICETQRIRSIVPVGIPHGCIE
DAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGK
RMCPGDELSRMLSCGLVSRLFRKQRIRLASKIPTAEEMRGTVGVTLAPPPVKYYCEPI
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggacctttattttatttggctggtaacgttcgtggctgggttttggattttcaaaaaa
ataaaggaatggcagaatttgccccccggaccttgggggttacctatcgtcggttatttg
cctttcattgatcgctatcatccacatatcaccttgacaaatttgtctaaaacatacgga
gctatttacggtctcaaaatgggcagcatatatgctgtagtgttatctgatcataaactt
gtaggagatacgttctcaaaagacagtttttctggacgagcacctctttacttaacacat
ggccttatgaatggaaatggaattatttgtgccgaaggcggtttgtggagggaccaaagg
aaattaataacatcgtggttgaaaagttttggaatgagtaagcacagtgtttcccgagaa
aaattggaaaaacgaatcgcttcaggagtatacgaaattttggaaaatatcgaaaaaact
tctgatgctgccttggaccttcctcatatgctgacgaattctttaggaaacgttgtcaat
gagataatattcggctttaagtttccacctgaagataaaacatggcaatggtttcgtcaa
atacaggaggaaggatgccatgagatgggagtcgcaggtgttgtaaacttcttgcccttt
atacgccatgtttcgccatcaacacgaaaaacaattgaagttctagtccgtggacaggca
cagacgcatactttgtacgcaagcatgatagatagacgaagaaaaatgttgggcttagag
aagcctaagggagccgaatatgctcctcacgaaaaccttttaaaactatatccaaatggc
catatcaaatgcataaaatacagcaaagtctctccgaacaccgagcatttctttgatccc
aatactcttattccgactgaaggagattgcatactggataattttctgttggagcaaaag
aaacgatttgagagtggagacccaacggcactgtatatgagagatgaacagttacatttt
ctactagcggatatgttcggtgccggactggatactacatcggtgactttagcttggttt
ttgctatacatggctttgtttccagaagaacaggaagaaatacgtaaagaaatcttatcc
gtatatccatatgacgatgatgttgatagttcaaggttacctcttcttatggcagcaatc
tgtgaaactcagaggattcgatcgattgttccagtgggaataccccatggttgtatagag
gacgcttacttgggtaactacagaatcccaaaaaatgccatggtgatcccattgcagtgg
gctattcacatggatcctaatgtttgggaagaaccagaaaaattcaaaccgcgtagattt
ttggctcaggatggtagtctacttaagcctcaagaattcattccgtttcaaactggtaag
cggatgtgtccgggtgacgaactgtcccgtatgttgtcgtgtggcctcgtaagtagacta
ttcagaaagcagcgtattcgactcgcatcaaaaataccgacagcagaagagatgcgtgga
accgtcggtgttacgttggcacctcctccggtgaaatactattgcgaaccaatttaa

DBGET integrated database retrieval system