Bombyx mori (domestic silkworm): 100169712 Help Entry 100169712         CDS       T02817                                  Symbol Bbx-a3 Name (RefSeq) bombyxin A-3 precursor   KO K04526   insulin Organism bmor  Bombyx mori (domestic silkworm) Pathway bmor04068   FoxO signaling pathway bmor04081   Hormone signaling bmor04140   Autophagy - animal bmor04150   mTOR signaling pathway bmor04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:bmor00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     100169712 (Bbx-a3)    04150 mTOR signaling pathway     100169712 (Bbx-a3)   09133 Signaling molecules and interaction    04081 Hormone signaling     100169712 (Bbx-a3)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100169712 (Bbx-a3)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     100169712 (Bbx-a3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bmor04052]     100169712 (Bbx-a3) Cytokines and neuropeptides [BR:bmor04052]  Neuropeptides   Unclassified    100169712 (Bbx-a3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  100169712 NCBI-ProteinID:  NP_001166890 UniProt:  P26726 LinkDB All DBs Position 11:complement(6551313..6551703) Genome browser AA seq 92 aa AA seqDB search MKILLAIALMLSTVMWVSTQQPQGVHTYCGRHLARTLANLCWEAGVDKRSDAQYVSYGSA WLMPYSEGRGKRGIVDECCLRPCSVDVLLSYC NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagattctccttgctattgcattaatgttgtcaacagtaatgtgggtgtcaacacaa cagccacaaggagtgcacacgtactgcgggcgccacttggctcgcactctggccaacctg tgctgggaagcgggcgtggacaagcgcagcgatgctcagtacgtgagctacggctccgcg tggctgatgccgtactcggaaggacgcggcaaacgaggcatcgtggatgagtgctgtctc agaccctgcagcgtggacgtgcttctgtcgtactgttag

DBGET integrated database retrieval system