KEGG   Bacillus velezensis JS25R: NG74_01920
Entry
NG74_01920        CDS       T03423                                 
Symbol
ppsC
Name
(GenBank) Plipastatin synthase subunit C
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bmp  Bacillus velezensis JS25R
Pathway
bmp01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bmp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    NG74_01920 (ppsC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bmp01008]
    NG74_01920 (ppsC)
Polyketide biosynthesis proteins [BR:bmp01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    NG74_01920 (ppsC)
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: AIU82000
LinkDB
Position
complement(1967665..1975314)
AA seq 2549 aa
MGQQPEIQDIYPLSFMQEGMLFHSLLDHDSRAYFEQAVFTINGQLDRGRFQKSIDAVFER
YDIFRTTFIHKNVAKPRQVVLKNRPSRVQFHDISHLDEKAQDKYADRFRKEDKDKGFDLQ
SDPLMRVSILKKAPERYVCIWSHHHIVMDGWCFGIVMKEFLMIYQSLGDGRLPSLEPVQP
YGKYIKWLMKQDRKEAEIFWKTRLADLEQSASLPKKSAEPNGELEQAVFTISEEQTNELK
NIAARAGATLNTVFQALWGILLQRVSRCDDAVFGSVVSGRPSDLAGVEKMVGLFINTIPV
RVKSGSFSFLELVRHLQQETLQAEAYSYYPLYDIQAQSPLKQALFDHIIVFENVPAQREI
ENVSQAGSFDFAVEDFTMEEVTNYGCSIKVIPGSSLYIRLNFDTGIYDRVFMKNIETFLR
HMMKSVISDPEMSASEIALLDACEARNMLDAFNRTETVEPPAPTLHGLFTRRAALSPHRP
ALRFPGGMLTYAELDQYTDRLAVWLRQKGVRKESMVGVLAERSPEMVVSVLAVLKAGGAY
VPLDPDYPEDRLRYMLEDCGACLLLAQPGLSVSGFSGETLEVSLSALTGETETGAVSEEA
DADSLAYIIYTSGSTGTPKGVAVEHRQAAAFLSGMQGQFPLTEEDIIVMKSSFSFDASIW
QLFWWTMSGASVYLLPAGWEKDPVRMIEVFSSEKVTTAHFIPAMVNSFLDALETEPEETR
TRLGRTLTRVFAGGEALSPLTAARFADLLPETVLIHGYGPTEATVDAAFYVCDRKRDSGR
TRLPIGKPVPGARLYVLDSGGTIQPAGVAGELYIAGTGVARGYLNRPELTEERFLDDPFY
PGERMYQTGDIARWTEDGLVEWLGRSDGQVKVRGYRIEPGEIEAAIRRIDGIREAAVTAR
TEHGETALYAYIEGRESDDVRAELAARLPAYMMPAQFIEMSEWPVTPSGKLDRRALPAPD
GAADRRVYTAPRNVTEMKLCALWEEVLKNGPVGIRDHFFERGGHSLKATALVSRIAKEFG
VQVPLQDIFARPTVEELALVIQDLEESPYEAIQPAKTQDTYPVSSAQKRMYVLQQLEDGG
IGYNMPAVLELTGPLDRGRLEETFRQLVERHESLRTSFETGPDGEPVQRIHDSVPFQLDE
AESADAFVRPFCLEEAPLFRAALVKESDERHLLLTDMHHIISDGVSVNTLIKEFGELYAG
RSLAPMRLQYKDYAVWQRSFQEKEGYQKQEAYWLKRLEGELPVLELPADKPRPAVRSFAG
GSVSCTLDAETASGLHRIARDHGSTLYMVLLAAYNTLLARLSGQEDIIVGSPIAGRPHKD
LEPILGMFVNTLAIRTEPKGDKRFTDYLAEVRQAALEAYEHQDYPFEELVERLGVQRDTS
RNPLFDVMFVLQNMERESLVLNKLHLTQAADTSHKTAKFDATLYASEGSDGSISFDFEFN
TDIYQKQTIEKWLSYFTRILTKVIENQAIPLGDIHVLDDAETNRVIYQFNQTKSDYPRHE
TISRLFERQAKETPDARAVVYDGQILTYRELNERANRIAAALRSNGVGPESVVALLTGRT
TELASGILGILKAGGAYLPIGDDVPRERAEWMLKDCKADILLQSDKLDGLPLSGKRLFIE
DIQTKAGLSSENPEPLGGPESLAYMIYTSGSTGAPKGVMIEQRSVIRLVKNSNYIDFTPK
DRLLFTSSLGFDVTTFEIFGPLLNGASLYVSDQETYLDSDVLETFIQQNGITTLWLTSSL
FNHLSEQNKDVFSGLSRLIIGGEALSPSHVNRVRNALPHLSVWNGYGPTENTTFSTCFLI
EQSYDHSIPIGRPVGNSTAYIINSRGTPQPIGVIGELCTGGDGVARGYFGRPELTQEKFV
PNPFVPGERMYRTGDLARWLPDGTIEYAGRMDDQVKIRGYRVELGEIEAALRSLDGVKEA
AVSVRTGQSGNKELIAYMSLQADMDTEKVRSSLSKQLPNYMVPAYMMELEKLPLTPNGKL
DRKNLPEPELTLQTAYTAPRNELEEQLSVIWQEVLGTKQVGIEDSFFELGGDSIKALQVS
ARLGRYGWKMTASDLFRHPSIKELAPLIRKAERVIDQRPVEGDIPWTPVQHWFLSQRMEN
RNHFNQSVMMFSSDALQKQPLKEALEHLVIHHDALRITVSEENESIRQINHGIQKAELYT
LDIWDMSETDTWEREIETEVAALQQRMDIEKGPLLKAGWFKTRSGDYLFITVHHLAVDGV
SWRILLEDLSAAYTQAVKGQPVQLPPKTDSFKQYAERLSEYAKSSKLMREEEYWRFIEEE
TAAELPYEKPQHQTGADSIRQTVSFTLTEEETSVLLQQVNRAYHTDTQDILLTAAALALR
DWTGGGRLRIAMEGHGREHIMPELDISRTVGWFTSMYPVLIDLNTAGSELGTAVKTVKDT
LGRIPDKGIGYGILKYMTPPEQKTIRFRQAPEISFNYLGQFNDTEDQHTFSLSGLASGHD
ITPTWQREQAVEMSAMAAQHKLHFSLSYPPSRFSKETMEQLLQTLQQYLRDIMAHCTGKE
EAEKTVSDFSSKTLTSDDLDSIASFVEEL
NT seq 7650 nt   +upstreamnt  +downstreamnt
atggggcagcaaccggaaatacaagatatatatcctttatcttttatgcaggagggcatg
ctttttcattctctgttggatcatgactcaagagcctacttcgaacaagcggtgtttacg
atcaacggacagcttgaccggggacgattccaaaaaagtatagatgctgtttttgaacga
tacgatattttccgtacgacatttattcataagaatgtggcgaagccccgccaagtcgtg
ttgaaaaacaggccgagccgcgttcaatttcatgatatttctcatttggacgagaaggca
caagacaaatatgccgaccggttcagaaaagaagataaagataaaggctttgatttgcaa
tcagaccctctcatgagagtctccattttgaaaaaagcgcccgaacgctatgtttgtata
tggagccatcatcatatcgtcatggacggctggtgcttcggaattgtcatgaaggaattt
ctgatgatctatcaatctctcggagacggacggcttccgtctctcgagcctgttcagcca
tatggaaagtatattaaatggctcatgaagcaggatcgtaaagaagccgagattttttgg
aaaacgagacttgccgatcttgagcaatcggcgtctcttccgaaaaaatccgcggaacca
aatggcgaacttgagcaggcggttttcaccatttctgaagagcagacaaatgagctgaag
aacattgcggcaagggcgggagcaacgctgaatacagtgttccaggcactgtggggcatt
ttgctgcagcgtgtcagccgctgtgatgacgccgttttcggttctgtcgtttccggccgg
ccgtcggatctcgcaggcgtggaaaaaatggtgggactgtttattaatacgattcccgtg
cgggtgaaaagcggttcattttcttttctggagctcgtcaggcatttgcagcaggagacg
ctgcaagcagaagcgtacagctattatccgctgtatgacattcaggcgcaaagccctttg
aagcaagcgctgtttgaccacattatcgtgtttgaaaatgtgccggcccagcgtgaaatt
gaaaatgtgagtcaggccggttcatttgattttgcggtagaagatttcacgatggaggaa
gtcacaaactacggatgcagcataaaggtgattccgggaagttctctttatatccgctta
aactttgatacgggtatatacgatcgtgtttttatgaagaatattgaaacatttttacgg
catatgatgaagtcagtcatttccgaccctgaaatgagcgcctccgagatcgcattgctg
gatgcgtgtgaagccagaaatatgctggatgcgtttaaccgtacagaaacggttgaaccg
ccggccccgacgcttcacggactgtttacccgccgcgccgcgctttcgccgcatcgtccg
gcgctccgttttccgggcggcatgctgacgtacgctgagctcgaccagtacacagacagg
ctcgccgtttggctccgccaaaagggcgtccgcaaagaaagcatggtcggcgtactcgct
gaacgctcgccggagatggtggtttcagtgcttgccgtgttaaaagcgggcggcgcctac
gtgccgcttgaccctgactatcctgaggacaggctgcgctatatgctcgaggactgcggc
gcctgcctcctgcttgcacagccgggattatccgtttccggtttttccggagaaacgcta
gaagtatctctttctgctctgacaggcgagacggagacaggggctgtctctgaagaagcg
gatgccgattcgctcgcttatatcatttatacgtccggttcgacgggaacaccgaaggga
gtggctgttgaacaccgtcaggccgccgcctttttatcagggatgcaagggcagtttccg
ttaacggaagaggatattatcgttatgaaatcatccttttcattcgacgcctccatctgg
caattgttttggtggacgatgtccggcgcctccgtgtatctgcttcctgccgggtgggag
aaagatcctgtgcggatgattgaagttttttcttctgaaaaggtgacgaccgcgcatttt
attccggcgatggtcaacagctttttagacgcgctggaaacggagcctgaggaaacaaga
acacgcctcggcagaacactgacacgcgtgtttgccggaggggaagctctttccccgctt
acggctgcccggtttgccgatcttctgccagagaccgtgcttattcacggctacgggccg
acagaagcgacggttgatgcggcgttttacgtctgtgaccgaaaacgggacagcggacgg
acaaggcttccgattggtaaacccgttcctggtgcccgtctgtatgtattagatagcgga
ggaaccatccagcctgcgggcgtggcaggagagttgtacatcgcggggacaggggtggcc
cggggctatctgaaccggcctgagctgacggaggagcgttttctcgatgatccgttttat
ccgggagagcgcatgtatcaaacgggcgatatcgcacgctggacagaagacggccttgtc
gaatggctcggccgttcagacggacaagtgaaagtccgcggctaccggatcgaaccgggg
gaaatcgaagcagcgatccggcgcatcgacggcattcgtgaggcggcggtcaccgcccgg
accgaacacggcgaaaccgcgctttacgcctatatcgaaggacgggaaagcgacgacgtg
cgggcggagcttgcggcacgccttccggcctacatgatgccggctcagtttatagagatg
agcgaatggccggtcacgccgagcggaaaacttgaccgccgcgcgctgccggctcccgac
ggagcggcagacagacgggtgtacaccgccccgcggaacgtcacggaaatgaagctttgc
gccctttgggaagaggtgctgaaaaacggccccgtcggcatccgggatcacttttttgag
cggggcggccattcgttaaaagcgacggctctcgtctcccgcatcgccaaagagttcggt
gttcaggtgccgttacaggacatcttcgcccgtccgacggtggaagagctcgctttggtt
attcaggacttggaagaaagcccgtatgaagcgattcagcctgcgaaaacacaagatacc
tatccggtgtcttcggcgcagaaacggatgtatgtgctccaacagcttgaagacggcggt
atcggctacaatatgccggctgtgctggaactgacgggcccgcttgaccgcggccggctg
gaggagacgttccggcagcttgtggagcggcatgagtcgctcagaacgtcctttgaaacg
gggcctgacggcgaaccggtgcagcgcatccatgacagcgtgccgtttcagctcgatgag
gccgagtcagctgacgcattcgtccggccgttttgtctggaggaagcgccgctcttccgt
gcggccctcgtgaaagaatcagacgaacgtcatcttttattaacggatatgcatcatatt
atttctgacggtgtgtccgtcaacaccttgattaaagaattcggcgagctgtacgcaggc
cgttcgcttgcgccgatgcgccttcaatataaagactatgccgtctggcagcggtcgttt
caggagaaagaaggatatcagaagcaggaagcgtattggctgaagcggctagaaggagag
cttccggtgcttgagcttccggctgacaagccccgtccggctgtcagaagctttgcgggc
ggcagcgtatcgtgcacgcttgacgctgaaacggcatccggccttcaccgcatcgcccgg
gatcacggctccactttgtatatggtgcttctcgccgcgtacaatacgttactcgcgcga
ttgagcgggcaggaagacatcatcgtcggctcgccgattgccgggcgcccgcacaaagac
ctcgaaccgattctcggcatgttcgtcaacacgctggccatcagaacggagccgaaagga
gacaaacggtttaccgattatttggcggaagtccgccaggcggcgcttgaagcgtatgag
catcaggattacccgtttgaagagcttgtggagcggctcggcgtgcagcgggacacaagc
cgcaatccgctgtttgatgtgatgtttgtgcttcaaaatatggagcgtgaatccctggtg
ttaaataagctgcatttgactcaagctgcggatacaagtcataaaaccgcaaagtttgat
gccacgctttacgcgtcagaagggtctgacggttccatcagctttgattttgaattcaat
acagatatctatcaaaaacagacaattgaaaaatggctttcttattttacccgtattctt
acaaaagtaattgaaaaccaagcgataccgcttggtgacattcacgtactggatgatgct
gaaacaaatcgcgtcatttatcagtttaatcagacgaaaagcgattacccaagacacgaa
accatcagccgtttatttgagcggcaggcaaaagaaacccccgatgcccgggcagttgta
tatgatggacaaatcttgacataccgtgagctgaacgaacgggctaacagaatagcggcg
gctctccgatcaaatggcgtcggtccggaaagcgttgtcgccttattaaccggccgcaca
acagagcttgcttccggaatcctcggaatattaaaagcgggaggcgcctacttgcctatc
ggtgacgatgtgccgcgggaacgggctgaatggatgcttaaagactgtaaagctgatatt
cttctccaatctgataaacttgacggtctgccgctttcaggaaaacgtttattcatagag
gatattcaaacaaaggccggcttgagttcggaaaatcccgaaccgctcggcggacctgaa
tcgttggcctacatgatttatacgtccgggtcaacaggtgcgccaaaaggcgtcatgatt
gaacagcgaagcgtgatccgccttgtgaaaaacagcaattatattgattttacgccgaaa
gacagactgttgtttacttcatcattaggatttgacgttacgacatttgaaatattcggt
ccgcttttaaacggcgcttctttatatgtaagtgaccaggaaacctatctcgactctgat
gttctggaaacatttatacagcaaaacggcattacgacactgtggctgacatcgtctctg
ttcaaccatttatcagaacaaaataaagacgtgttttccggattatcccgattgattatc
ggcggggaagcactgtccccgagccatgtaaaccgggttcggaatgcgctgccgcatctc
tcagtatggaatggatacggaccgactgaaaacacgacgttctcgacttgctttttgatt
gaacaatcatacgatcattcaatcccgatcggccgccctgtcggaaattcaaccgcatat
atcataaacagcaggggaacaccgcagccgatcggcgtcatcggcgaattgtgcacgggg
ggagacggtgtggcaagaggatatttcggccgccctgagctgacgcaagaaaaatttgtc
cctaatccttttgttcccggagaacggatgtaccgcaccggagatttagcccgctggctg
ccggacggaacgatcgaatatgccgggcggatggatgatcaagtgaaaatccgcggttat
cgggtcgagctgggagagattgaagccgcactgaggagcctggacggtgtgaaagaagct
gccgtgtcagtcagaaccgggcagtccggcaataaagaactgatcgcatatatgagtctg
caggcggacatggatacagaaaaagtgcgttcttcattgtctaagcaactgccgaattac
atggttccggcctatatgatggaacttgagaagctgccgcttacgccgaacggtaaattg
gatcggaaaaatcttcccgaaccggagcttacgcttcaaaccgcgtacacagctccccgc
aatgagcttgaagaacagctttccgtgatctggcaggaagtgctcggcacaaaacaagtc
gggattgaggactcattttttgagttgggcggcgattcaatcaaagcgctgcaagtttcc
gcacggctcggacgctatgggtggaaaatgacggcaagtgacttattccggcacccgtcc
attaaggaactcgcgcctcttatccggaaagcggaaagagtcatcgatcagcggccggtg
gaaggagacataccttggacacccgttcagcactggtttttatcacagcggatggaaaac
agaaatcatttcaatcagtccgtcatgatgttcagctctgacgcattgcaaaaacagccg
ctcaaagaagccttggagcatcttgtcattcatcatgatgcactccggatcaccgtcagt
gaagaaaacgaaagtatcagacaaatcaatcacggtattcaaaaagctgagctgtacacc
ttggacatttgggatatgtctgagacagatacttgggaaagagaaatagaaactgaagtg
gctgcgctccaacagcggatggatattgaaaaagggccgttattaaaagccggctggttc
aaaacccggtccggggattatttattcatcaccgtacatcacctggcggttgacggagtg
tcatggcgtattctgctggaggatttatctgccgcttacactcaagctgtaaaaggtcag
ccggtccagcttccgccaaagaccgattcgtttaagcaatacgctgaaaggctttcggaa
tacgcaaaaagcagcaagctgatgcgtgaagaagaatattggcgttttattgaagaagaa
acagccgccgaacttccttatgaaaaaccgcagcatcagacgggagccgacagcattcgg
caaacggtaagctttacgcttacagaagaagaaacgtccgttttgcttcagcaggtcaac
cgggcctaccataccgatacgcaagatattcttctgaccgccgcagctttggctttacgg
gactggacagggggcggcagactgcgcatcgcgatggaagggcacgggagagagcacatc
atgccggagctcgacatcagccgcaccgtaggctggtttacctccatgtatccggtgctc
attgacttgaatacagcaggctcagaacttgggacggcggtaaaaacggtcaaagacaca
ctcggaagaataccggataaaggaataggctacggcattttaaaatacatgacaccgcct
gaacaaaaaacaatccgcttcagacaagcgcctgaaatcagctttaactatttagggcaa
ttcaacgatacagaagatcagcacacgttcagcctgtccggtctggcaagcgggcacgac
atcacgccgacgtggcagcgggaacaagcggtggaaatgagcgcgatggccgcacaacat
aaacttcacttcagtttgagctatccgccgagccgcttctccaaagaaacgatggaacag
ctgctgcaaaccttacagcaatatttgcgtgatattatggcgcactgcacagggaaagag
gaagcagaaaaaaccgttagtgattttagcagcaaaacgttaacatctgatgatttggac
agcatagcgagttttgtcgaggaactgtag

DBGET integrated database retrieval system