Balaenoptera musculus (blue whale): 118881825 Help Entry 118881825         CDS       T09887                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus04080   Neuroactive ligand-receptor interaction bmus04081   Hormone signaling bmus04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:bmus00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     118881825 (GHRH)    04081 Hormone signaling     118881825 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     118881825 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bmus04052]     118881825 (GHRH) Cytokines and neuropeptides [BR:bmus04052]  Neuropeptides   GPCR binding    118881825 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  118881825 NCBI-ProteinID:  XP_036682987 UniProt:  A0A8B8VDL1 LinkDB All DBs Position 15:22380944..22389633 Genome browser AA seq 106 aa AA seqDB search MLLWVFFLVTLTLSSGSHGSPPSQPLRMPRYADAIFTNSYRKVLGQLSARKLLQDIMSRQ QGERNQEQAAKVRLGRQVDSMWTDQKQVALENILVTLLQEHRNSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctcgtgaccctcaccctcagcagcggctcccacggctcc ccgccctctcagcccctcaggatgccgaggtacgcagacgccatcttcaccaacagctac cggaaggtgctgggccagctgtctgcccgcaagcttctccaggacatcatgagcaggcag cagggagagagaaaccaggagcaagcagcaaaggtacggcttggccgtcaggtggacagc atgtggacagaccaaaagcaggtggcgttggagaacatcctggtgaccctgctgcaggag cacaggaattcccaaggatga

DBGET integrated database retrieval system