KEGG   Brassica napus (rape): 106346160
Entry
106346160         CDS       T04128                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 6
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
bna  Brassica napus (rape)
Pathway
bna00270  Cysteine and methionine metabolism
bna00280  Valine, leucine and isoleucine degradation
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
bna01240  Biosynthesis of cofactors
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    106346160
   00280 Valine, leucine and isoleucine degradation
    106346160
   00290 Valine, leucine and isoleucine biosynthesis
    106346160
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106346160
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106346160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bna01007]
    106346160
Enzymes [BR:bna01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     106346160
Amino acid related enzymes [BR:bna01007]
 Aminotransferase (transaminase)
  Class IV
   106346160
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 106346160
NCBI-ProteinID: XP_013640870
LinkDB
Position
A6:1611712..1613746
AA seq 359 aa
MAPSVQPSSSPLRTSEGDEKYANVKWEELGFSLIPTDCMYVAKCRQGESFTEGKIVPYGD
ISISPCCPILNYGQGLFEGLKAYRTEDDRILIFRPHENALRMQDGAERLCMSSPSVEFFV
EAVKQTVLANKKWVPPPGKGALYIRPLLIGSGAILGVAPAPEYTFLIYASPVGDYHKASS
GLNLKVDHKSHRAHSGGTGGVKSCTNYSPVVKSLVEAKSSGFSDVLFLDAATGRNIEEAS
ACNIFIVKGNIVSTPPTSGTILPGITRKSVSELARDIGYQVQERDVSVDELLEAEEVFCT
GTAVVVKAVETVTFHDKKVKYRTGEESLSKKLHSMLTSIQTGLVEDTKGWMLDIDPCQG
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggctccatctgtgcaaccttcttcgtcacctcttcgtaccagtgaaggcgatgaaaaa
tatgcgaatgtgaaatgggaagagctcggattctctctgatcccgacagattgcatgtat
gtggcgaagtgcagacaaggagagagtttcactgaagggaagattgttccttacggtgac
atttcaatcagcccttgttgtcctattctcaactatggccagggactatttgaaggtctg
aaagcttacaggacagaagacgaccggattctgattttcaggcctcacgaaaacgctctc
cgcatgcaagatggtgcagagaggctttgtatgtcatcaccttctgtggagttcttcgtg
gaagctgttaagcaaactgtgcttgccaacaagaaatgggttcctcctccgggtaaagga
gctttgtatataaggcctctgctaatagggagtggcgctatacttggagtagctccagcg
cctgagtacacgttcctcatttatgcatctcccgtaggagattaccataaggcaagctca
ggtctgaaccttaaagttgatcataaaagtcaccgagcacattctggtggaactggtggt
gtcaagagttgcacaaactattctccagttgtgaagtcgttggtggaagcaaagtcatca
ggcttctctgatgtcttgttcctagatgctgcaactgggagaaacatcgaagaggcgtct
gcatgtaacatcttcattgtcaaggggaacattgtgtccactccaccgacttcaggaacc
attttaccaggaatcacaaggaaaagcgtaagcgagctagctcgtgatatcggctaccag
gttcaagaacgagatgtatctgtggatgagttattagaggcagaagaagtgttctgcacg
ggaactgcagtggtcgttaaagctgttgaaaccgtgaccttccatgacaagaaggtgaaa
tacaggacaggagaagagtcgttgtctaagaagcttcactcgatgttgacgagtattcag
acaggtcttgttgaagatacaaaaggttggatgttggacatcgatccttgtcaaggttga

KEGG   Brassica napus (rape): 106346218
Entry
106346218         CDS       T04128                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 2, chloroplastic-like
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
bna  Brassica napus (rape)
Pathway
bna00270  Cysteine and methionine metabolism
bna00280  Valine, leucine and isoleucine degradation
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
bna01240  Biosynthesis of cofactors
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    106346218
   00280 Valine, leucine and isoleucine degradation
    106346218
   00290 Valine, leucine and isoleucine biosynthesis
    106346218
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106346218
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106346218
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bna01007]
    106346218
Enzymes [BR:bna01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     106346218
Amino acid related enzymes [BR:bna01007]
 Aminotransferase (transaminase)
  Class IV
   106346218
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 106346218
NCBI-ProteinID: XP_013640938
LinkDB
Position
A6:3503388..3506447
AA seq 387 aa
MNKTISSLRKSLVLPLHVHIRTLQSFSKYNAQAASALQEERKKPTYQDDNEYADMDWDNL
GFGLTPADYMYVMKCSKDGEFTKGELSRFGNIQLSPSAGVLNYGQAIYEGTKVYRKENGK
LLLFRPDHNAVRMQLGAERMLMPSPSVDQFVDAVKQTAFANKRWVPPSGKGSLYIRPLLM
GSGPVLGLAPAPEYTFIIYASPVGNYFKEGTAALNLYVEEEYVRAAPGGAGGVKSITNYA
PVLKALSRAKSRGFSDILYLDAVKKKYLEEASSCNVFVVKGRTISTPATNGTILEGITRK
SVMEIASDQGYKVVEKAVHVDEVMDADEVFCTGTAVGVAPVGTITYQDKRIRYETGDESV
CQKLRSVLVGIQTGTIEDTKGWVTCIN
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgaacaaaacaatctcatctctgcgcaaaagtctggtgttacctcttcatgtacatatt
cgcacgctacaatctttttctaagtacaacgcacaagctgcatcagcgttgcaagaagaa
cgtaagaaacctacttatcaagatgataatgagtatgctgatatggattgggataatctc
gggtttggtctaactccagctgattacatgtacgtcatgaaatgctcaaaagacggtgag
ttcacaaaaggtgaacttagccgctttggtaatattcagctaagtccttctgctggagtc
ttgaactatggacaggcgatatatgaaggtacaaaagtatacaggaaagagaacgggaag
cttcttttgtttcgacctgatcacaacgctgtccgaatgcagcttggagctgaacggatg
ctcatgccttctccttctgttgatcagtttgttgatgcagttaaacaaaccgcttttgca
aacaaacgttgggttcctccttcagggaaagggtctttgtacattagacctctgttgatg
ggaagtggtccagttcttggtttagcacctgcacctgaatatacattcattatctatgca
tctcctgttggtaactacttcaaggaaggtaccgctgctcttaacctctatgtagaggaa
gagtatgtccgtgcagctcctggtggagctggaggagtcaagagcatcacaaactatgcc
ccggttttgaaagcactaagcagagccaagagccgtgggttttcagacattctttatcta
gacgctgtaaagaagaagtatcttgaggaggcttcttcttgcaacgtctttgttgtaaag
ggtcggacaatctcaactcctgccactaatggaactatcctagaggggattacaaggaag
agtgtgatggagatcgcaagtgatcaaggttacaaggtagtagagaaggcagttcatgtg
gatgaagtaatggatgcagatgaagttttctgcactggaactgctgtaggagtagctcct
gtgggcactataacatatcaggacaaaagaataaggtatgaaactggggatgaatctgtc
tgccagaaactgcggtcggtccttgtcggtattcagacaggaaccattgaagataccaag
ggatgggttacatgcatcaactga

KEGG   Brassica napus (rape): 106346221
Entry
106346221         CDS       T04128                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 1, mitochondrial-like isoform X1
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
bna  Brassica napus (rape)
Pathway
bna00270  Cysteine and methionine metabolism
bna00280  Valine, leucine and isoleucine degradation
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
bna01240  Biosynthesis of cofactors
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    106346221
   00280 Valine, leucine and isoleucine degradation
    106346221
   00290 Valine, leucine and isoleucine biosynthesis
    106346221
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106346221
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106346221
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bna01007]
    106346221
Enzymes [BR:bna01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     106346221
Amino acid related enzymes [BR:bna01007]
 Aminotransferase (transaminase)
  Class IV
   106346221
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 106346221
NCBI-ProteinID: XP_013640941
LinkDB
Position
A6:3497978..3502422
AA seq 386 aa
MALRCLSQSSTAFSYLSKICGFRMHGTKAAVSVVEEHVSEMVGTGREDEEYADVDWDNLG
FSLVRTDYMFATRSSGEGNFEQGCLSRYGNIELNPAAGILNYGQGLIEGMKAYRGENGRV
LLFRPELNAMRMKKGAERMCMHSPSVQQFIEGVKQTVLANRRWVPPPGKGSLYLRPLLFG
SGASLGLSAASEFTFLVFGSPVQNYFKEGTSALDLYVEEVIPRAYIGGSGGVKAISNYGP
VLEVMRRAKARGFSDVLYLDAETKKNIEEVSASNIFLVKGNTIVTPATTGTILGGITRKS
VIEIAIDLGYKVEERVVPVEELKEAEEVFCTGTATGVASVGSITYQNTRTEYKVGDGLVT
QQLRSILVGIQTGSIQDTKNWVLEID
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggctcttcgctgcttatctcaatcttcaacagctttctcttatctctctaagatctgt
ggatttcgtatgcatgggactaaggcagcagtttctgttgtagaagaacatgtctcggag
atggtggggacaggacgtgaggatgaagagtatgctgatgtggattgggacaacctcgga
ttcagtcttgtacggacagattacatgtttgccaccagaagttccggagaaggaaacttc
gaacaaggttgccttagccgttacggcaacatcgagctcaaccctgctgctggaattctc
aactacggccagggactaatcgaggggatgaaagcgtacagaggagaaaatggtagggtt
cttctctttcgtccagagttaaatgcgatgcgtatgaagaaaggagcagagagaatgtgt
atgcattctccctctgttcaacaatttattgaaggtgttaagcagactgttcttgcaaac
agacgctgggttcctcctcctggaaaaggctccttgtatctcagaccattgttgtttgga
agtggagcaagcttgggtttgtctgcagcatcagagtttacgtttcttgtgtttggttct
cctgttcaaaactattttaaagaaggtacatcagcactggatctctacgttgaggaggtg
attccacgcgcgtatattggagggagtggtggcgttaaggccatttctaattacggtcca
gtgcttgaagtgatgagaagagcgaaagcgagagggttttccgatgtattgtatctggac
gcagaaactaagaagaacatagaggaagtttctgcttctaatatattccttgtaaagggg
aatacaatagtgactccagctacaaccgggacgattcttggagggatcacacgaaagagc
gtaatcgaaattgctattgatcttggttacaaggtggaagaacgagtagttccggtagaa
gaactgaaggaagcagaagaagttttctgcactggaactgctaccggagttgcttctgtt
gggagcatcacgtatcagaacaccaggactgagtacaaagttggagatgggcttgtaacg
cagcaacttcgatctattcttgtcggaatacaaactggttctatccaagacactaagaat
tgggtgttggagatagattaa

KEGG   Brassica napus (rape): 106347397
Entry
106347397         CDS       T04128                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 3, chloroplastic-like
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
bna  Brassica napus (rape)
Pathway
bna00270  Cysteine and methionine metabolism
bna00280  Valine, leucine and isoleucine degradation
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
bna01240  Biosynthesis of cofactors
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    106347397
   00280 Valine, leucine and isoleucine degradation
    106347397
   00290 Valine, leucine and isoleucine biosynthesis
    106347397
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106347397
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106347397
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bna01007]
    106347397
Enzymes [BR:bna01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     106347397
Amino acid related enzymes [BR:bna01007]
 Aminotransferase (transaminase)
  Class IV
   106347397
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 106347397
NCBI-ProteinID: XP_013642378
LinkDB
Position
A6:complement(13874429..13876855)
AA seq 412 aa
MERATISPSLSQNYLLCPSRALTTRLHYFSTTRNLSSPSSSSSSSIKLQHSSSNGGTSLT
RCNAVLSNSPSSAEVADIDWDNIGFGLKPTDYMYVMKCNLDGEFSKGELQRFGNIEVSPS
AGVLNYGQGLFEGMKAYRQQDGKNILLFRPEENATRMRSGAERMCMPAPTVDQFVEAVKA
TVLANKRWVPPAGKGSLYIRPLLMGTGAVLGLAPAPEYTFLVYVSPVGNYFKEGVAPINL
IVESEFHRATPGGTGGVKTIGNYAAVLKAQSIAKSKGYSDVLYLDCLHKRYLEEVSSCNI
FIVKDKVISTPEIKGTILPGITRKSIIDVARTQGFKVEERNVTVDELLEADEVFCTGTAV
VVSPVGSITHKGKRVSYGEGSFGPVSEKLYTVLTSLQMGLSEDNMNWTVNLS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggagagagcaaccatttccccgagcctgagtcaaaactacctactttgtccttcacgc
gccttaaccacgcgcctccactacttctccacgactcgaaacttatcatcgccttcgtct
tcgtcttcctcctccatcaagcttcagcattcttcttccaatggcggaacctcccttact
cgttgcaacgccgtcctctccaattcgccttccagtgcggaggtagcagacatagattgg
gacaacatagggttcggtctgaagccgactgattacatgtacgtcatgaaatgcaacctc
gatggggagttctcaaagggtgaattgcaacgttttgggaacattgaagtcagcccatct
gctggtgttctcaactatggacagggattgttcgaaggaatgaaagcttacagacagcaa
gacggtaagaacatcctcctctttcgtcctgaagagaatgcaacgcgtatgagaagtggt
gccgagaggatgtgtatgcctgctcctaccgttgaccagtttgtcgaagctgtcaaagca
accgtattagcaaacaaacgctgggttccacctgcagggaaaggttctttgtatattaga
ccgttgctaatgggaactggagctgttcttggtcttgcccctgctccagaatatactttc
cttgtctatgtttctcctgttggaaactacttcaaggaaggtgtggcaccgatcaatttg
attgtggagagtgaatttcaccgtgcaacacctggtggtaccggtggtgttaagaccatt
ggcaactacgctgcagtactaaaagcacagtcgattgcgaaatctaaaggatattccgac
gttttgtaccttgattgccttcacaaaagataccttgaggaggtctcctcttgcaatatc
ttcattgtcaaggacaaagtgatatctactcctgaaataaaaggaaccattttaccaggg
attacgcggaaaagtataatcgacgtggctcgtacccaagggtttaaggtggaggaaagg
aatgtgacagtggacgagttactagaagcggacgaagttttctgcacaggaaccgccgtg
gttgtctctcccgttggaagcattacccacaaaggcaaaagagtatcttatggagaaggt
agctttggacctgtctccgagaaactctacaccgttctgacaagcttgcagatgggtctg
agcgaggacaacatgaactggactgttaatctgagttag

KEGG   Brassica napus (rape): 106350617
Entry
106350617         CDS       T04128                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 2, chloroplastic-like
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
bna  Brassica napus (rape)
Pathway
bna00270  Cysteine and methionine metabolism
bna00280  Valine, leucine and isoleucine degradation
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
bna01240  Biosynthesis of cofactors
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    106350617
   00280 Valine, leucine and isoleucine degradation
    106350617
   00290 Valine, leucine and isoleucine biosynthesis
    106350617
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106350617
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106350617
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bna01007]
    106350617
Enzymes [BR:bna01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     106350617
Amino acid related enzymes [BR:bna01007]
 Aminotransferase (transaminase)
  Class IV
   106350617
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 106350617
NCBI-ProteinID: XP_013645933
LinkDB
Position
C5:5759838..5762310
AA seq 387 aa
MNKTISSLRKSLVLPLHVHIRTLQSFSKYNAQAASALQEERKKPTYQDDNEYADMDWDNL
GFGLTPADYMYVMKCSKDGEFTKGELSRFGNIQLSPSAGVLNYGQAIYEGTKVYRKENGK
LLLFRPDHNAVRMELGAERMLMPSPSVDQFVDAVKQTAFANKRWVPPSGKGSLYIRPLLM
GSGPVLGLAPAPEYTFIVYASPVGNYFKEGTAALNLYVEEEYVRAAPGGAGGVKSITNYA
PVLKALSRAKSRGFSDILYLDAVKKKYLEEASSCNVFVVKGRTISTPATNGTILEGITRK
SVMEIASDQGYKVVEKAVHVDEVMDADEVFCTGTAVGVAPVGTITYQDKRIRYETGDESV
CQKLRSVLVGIQTGTIEDTKGWVTCIN
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgaacaaaacaatctcatctctgcgcaaaagtctggtgttacctcttcatgtacatatt
cgcacgctacaatctttttctaagtacaacgcacaagctgcatcagcgttgcaagaggag
cgtaagaaacctacttatcaagatgataatgagtatgctgatatggattgggataatctc
gggtttggtctaactccagctgattacatgtacgtcatgaaatgctcaaaagacggtgag
ttcactaaaggtgaacttagccgctttggtaatattcagctaagtccttctgctggagtc
ttaaactatggacaggcgatatatgaaggtacaaaagtatacaggaaagaaaacgggaag
cttcttttgtttcgacctgatcacaacgctgtccgaatggagcttggagctgaacggatg
ctcatgccttctccttctgttgatcagtttgttgatgcagttaaacaaaccgcttttgca
aacaaacgttgggttcctccttcagggaaagggtctttgtacataagacctctgttgatg
ggaagtggtccagttcttggtttagcacctgcacctgaatatacattcattgtctatgca
tctcctgttggtaactacttcaaggaaggtaccgctgctcttaacctctatgtagaagaa
gagtatgtccgtgcagctcctggtggagctggaggtgtaaagagcatcacaaactatgcc
ccggttttgaaagcactaagcagagccaagagccgtgggttttcagacattctttatcta
gacgctgtaaagaagaagtatcttgaggaggcttcttcttgcaacgtctttgttgtaaag
ggtcggacaatctcaactcctgccactaatggaacaatcctagaggggattactcggaaa
agtgtgatggagatcgcaagtgatcaaggttataaggtagtagagaaggcagttcatgtg
gatgaagtaatggatgcagatgaagttttctgcactggaactgctgttggagttgctcct
gtaggcactataacatatcaggacaaaagaataaggtatgaaactggggatgaatctgtc
tgccagaaactgcggtcggtcctggtcggtattcagacaggaaccattgaagataccaag
ggatgggttacatgcatcaactga

KEGG   Brassica napus (rape): 106350639
Entry
106350639         CDS       T04128                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 1, mitochondrial isoform X1
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
bna  Brassica napus (rape)
Pathway
bna00270  Cysteine and methionine metabolism
bna00280  Valine, leucine and isoleucine degradation
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
bna01240  Biosynthesis of cofactors
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    106350639
   00280 Valine, leucine and isoleucine degradation
    106350639
   00290 Valine, leucine and isoleucine biosynthesis
    106350639
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106350639
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106350639
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bna01007]
    106350639
Enzymes [BR:bna01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     106350639
Amino acid related enzymes [BR:bna01007]
 Aminotransferase (transaminase)
  Class IV
   106350639
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 106350639
NCBI-ProteinID: XP_013645956
LinkDB
Position
C5:5752093..5757889
AA seq 387 aa
MALRCLSQSSSTTFSYLSKICGFRMHGTKAAVSVVEEHVSKMVGTGREDEEYADVDWDNL
GFSLVRTDYMFATRSCREGNFEQGCLSRYGNIELNPAAGILNYGQGLIEGMKAYRGEDGR
VLLFRPELNAVRMKKGAERMCMHSPSVQQFIEGVKQTVLANRRWVPPPGKGSLYLRPLLF
GSGASLGLSAASEFTFLVFGSPVQNYFKEGTSALNLYVEEVIPRAYLGGSGGVKSISNYG
PVLEVMRRAKARGFSDVLYLDAETKKNMEEVSASNIFLVKGNTIVTPATNGTILGGITRK
SVIEIAIDLGYKVEERVVPVEELKEAEEVFCTGTATGVASVGSITFQNTRTEYKVGDGLV
TQQLRSILVGIQTGSIQDTKNWVLEID
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggctcttcgctgcttatctcaatcttcatcaacaactttctcttatctctctaagatc
tgtggatttcgtatgcatgggactaaggcagcagtttctgttgtagaagaacatgtctcg
aagatggtggggacaggacgtgaggatgaagagtatgctgatgtggattgggacaacctc
ggattcagtcttgtacggacagattacatgttcgccaccagaagttgcagagaaggaaac
ttcgaacaaggttgccttagccgttacggcaacatcgagctcaaccctgctgctggaatt
ctcaactacggccagggattaatcgaggggatgaaagcttacagaggagaagatggtagg
gttcttctatttcgtccagagttaaatgccgtgcgtatgaagaaaggagcagagagaatg
tgtatgcattctccttctgttcaacagtttattgaaggtgttaagcaaaccgttcttgca
aacagacgctgggttcctcctcctggaaaaggctccttgtatctcagaccattgttgttt
ggaagtggagcaagcttgggtttgtctgcagcatcagagtttacgtttcttgtgtttggt
tctcctgttcaaaactattttaaagaaggtacatcagcactgaatctctacgttgaggag
gtgattccacgcgcgtatcttggaggaagtggtggcgttaagtccatttctaattacggt
ccagtgcttgaagtcatgagaagagcgaaagcgagagggttttcggatgttttgtatctg
gatgcagaaactaagaagaatatggaggaagtttctgcttctaatatattccttgtgaag
gggaatacaatagtgactccagctacaaacgggacgattctcggagggatcacacgaaag
agcgtaatcgaaattgctattgatcttggttacaaggtggaagaacgagtagttccggta
gaagaactgaaggaagcagaagaagttttctgcactggaactgccaccggagttgcttct
gttgggagcatcacgtttcagaacaccaggactgagtacaaagttggagatgggcttgta
acgcagcaacttcgatctattcttgtcggaatacaaactggttctatccaagacactaag
aattgggtgttggagatagattaa

KEGG   Brassica napus (rape): 106360576
Entry
106360576         CDS       T04128                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 3, chloroplastic-like
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
bna  Brassica napus (rape)
Pathway
bna00270  Cysteine and methionine metabolism
bna00280  Valine, leucine and isoleucine degradation
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
bna01240  Biosynthesis of cofactors
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    106360576
   00280 Valine, leucine and isoleucine degradation
    106360576
   00290 Valine, leucine and isoleucine biosynthesis
    106360576
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106360576
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106360576
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bna01007]
    106360576
Enzymes [BR:bna01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     106360576
Amino acid related enzymes [BR:bna01007]
 Aminotransferase (transaminase)
  Class IV
   106360576
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 106360576
NCBI-ProteinID: XP_013655650
LinkDB
Position
A1:19921509..19924127
AA seq 414 aa
MERATHSPSLNQSYLLSPSRASTTRLHSFSFTRNLSPSTSSIKLQRSSSSVSSSGVSLTR
CNAVLSNSSSSKDVTELADIDWDNIGFGLKPTDYMYVMKCNLGGEFSNGELQRFGNIEVS
PSAGVLNYGQGLFEGMKAYRKQDGKNILLFRPEENATRMRCGAERMCMPAPTIDQFVEAV
KATVLANKRWVPPPGKGSLYIRPLLMGTGAVLGLAPAPEYTFLVYVSPVGNYFKEGVSPI
NLIVESEFHRATPGGTGGVKTIGNYAAVLKAQSVAKAKGYSDVLYLDCIYKRYLEEVSSC
NIFIVKDNVISTPEIRGTILPGITRKSIVDVARSQGLKVEERNVTVDELLEADEVFCTGT
AVVVSPVGSITYKGKRVSYGEGSFGPVSEKLYTVLTSLQMGLTEDNMKWTVNLS
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggagagagctacacattccccgagtcttaatcaaagttacctgctttctccttcacgc
gcctccaccacgcgcctccactcattctccttcactcggaacttatcgccatcgacttcc
tccatcaagcttcagcgttcttcttcctctgtctcttcaagtggagtctcccttactcgg
tgcaacgccgtgctttcaaactcttcttccagtaaggatgttaccgaactagccgacata
gattgggacaacatcgggttcggtcttaagccgaccgattacatgtacgtcatgaaatgt
aaccttgggggtgagttctctaatggtgagttgcaacgttttgggaacattgaagtcagc
ccatctgctggtgtactcaactacggacaggggttgttcgaagggatgaaagcttacaga
aagcaagacggtaagaatatcctcctcttccgtcctgaagagaatgctacacgtatgaga
tgtggtgctgagaggatgtgtatgcctgctcctaccattgaccagtttgtcgaagctgtc
aaagcaactgtcttagcaaacaaacgttgggtcccacctccaggtaaaggctccttatat
atcagaccgttgctaatgggaactggagctgttcttggtcttgctcctgcaccagaatat
actttccttgtctatgtctctcctgttggaaactacttcaaagaaggtgtgtcgccaatc
aatttgattgtggaaagtgaatttcaccgtgcgacacctggtggtactggaggtgttaaa
accattggcaattatgctgcagtactaaaagcacagtctgttgcgaaagctaaaggatat
tccgatgtattgtaccttgattgcatctacaaaagatatcttgaggaggtctcctcatgc
aatatcttcattgtcaaggataatgtgatctctactcctgaaataagaggaaccatctta
ccagggattacaaggaaaagtatagttgacgttgctcgtagccaagggcttaaggtggag
gaacggaatgtgacagttgatgagttactagaggcggacgaggttttctgcactggaacc
gctgtggttgtctctcccgttggaagcattacttacaaaggcaaaagagtatcgtacgga
gaaggtagctttggacctgtctcggagaaactctacaccgttctgacaagcttgcaaatg
ggtctgactgaggataacatgaaatggactgtgaatctcagttga

KEGG   Brassica napus (rape): 106362399
Entry
106362399         CDS       T04128                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 1, mitochondrial-like isoform X1
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
bna  Brassica napus (rape)
Pathway
bna00270  Cysteine and methionine metabolism
bna00280  Valine, leucine and isoleucine degradation
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
bna01240  Biosynthesis of cofactors
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    106362399
   00280 Valine, leucine and isoleucine degradation
    106362399
   00290 Valine, leucine and isoleucine biosynthesis
    106362399
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106362399
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106362399
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bna01007]
    106362399
Enzymes [BR:bna01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     106362399
Amino acid related enzymes [BR:bna01007]
 Aminotransferase (transaminase)
  Class IV
   106362399
SSDB
Motif
Pfam: Aminotran_4 TAL_effector
Other DBs
NCBI-GeneID: 106362399
NCBI-ProteinID: XP_013657745
LinkDB
Position
A8:complement(26603688..26607459)
AA seq 386 aa
MALRCLLKSPTTSSYISKICGFRMHGTKAVASVVEEHVSAMLRSEREDEEYADVDWDNLG
FSLVPTDYMFATKSCREGNFEQGCLSRYGNMELNPAAGILNYGQGLIEGMKAYRGEDGRV
LMFRPELNAMRMKNGAERMCMHSPSVQQFMEGVKQTVLANKRWVPPPGKGSLYLRPLLFG
SGASLGVSAASEYTFVVFGSPVQNYFKEGTAALNLYVEEVIPRAYIGGTGAVKAISNYGP
VLDAMRSAKARGFSDVLYLDAETKKNIEEVSAANIFLVKGNTIVTPATNGTILRGIIRES
VIEIALDLGYKVEERVVPVEEMKEAEEVFCTGTAAGIASVGSITFQNIRTEYKVGDGLVT
QQLRSILVGIQTGSIQDTKGWVLEID
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggctcttcgctgcttacttaaatctccaacaacttcctcttatatttctaagatctgt
ggatttcgtatgcatgggaccaaggcagtagcttctgttgtagaagaacatgtctcagcg
atgctgaggtcagaacgtgaggatgaagagtatgctgatgtggactgggacaacctcgga
ttcagtcttgtaccaacagattacatgttcgccaccaaaagttgtagagaaggaaacttc
gaacaaggttgccttagccgttacggcaacatggaactcaaccctgctgctggaattctc
aactatggccagggactaatcgaggggatgaaggcgtacagaggagaagacggcagggtt
cttatgtttcgtccagagctaaacgcgatgcgtatgaagaatggagctgagagaatgtgt
atgcattctccttctgttcagcagtttatggaaggtgtcaagcagaccgttctcgcaaac
aaacgttgggttcctcctccgggaaaaggctcgttgtatctcagaccgttgttgtttgga
agcggagcaagcctgggtgtgtctgcagcttcagaatacacttttgttgtgtttggctct
cctgttcagaactattttaaggaaggtacagcagcgttgaacctctacgttgaggaggtg
attccacgcgcgtatattggaggaactggtgccgttaaggccatttctaattacggtcca
gtgcttgacgcgatgagaagtgcgaaagcgagaggattctcggatgtattgtatcttgat
gcagaaacaaagaagaacatagaagaagtttcagctgctaatatattccttgttaagggg
aatacaatagtaactccagctacaaatgggactattctcagagggatcatacgagagagc
gttatcgaaattgcccttgatcttggttataaggtggaagaacgagtagttccggtagaa
gaaatgaaggaagcagaagaagttttctgcaccggaactgccgctggaattgcttctgtt
ggaagcatcacgtttcagaacataaggactgagtacaaagtgggagatgggctagttaca
caacaacttcgatctattcttgtcggaatacaaactggttctatacaagacacaaaaggc
tgggtgctggagattgactaa

KEGG   Brassica napus (rape): 106362401
Entry
106362401         CDS       T04128                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 2, chloroplastic-like
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
bna  Brassica napus (rape)
Pathway
bna00270  Cysteine and methionine metabolism
bna00280  Valine, leucine and isoleucine degradation
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
bna01240  Biosynthesis of cofactors
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    106362401
   00280 Valine, leucine and isoleucine degradation
    106362401
   00290 Valine, leucine and isoleucine biosynthesis
    106362401
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106362401
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106362401
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bna01007]
    106362401
Enzymes [BR:bna01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     106362401
Amino acid related enzymes [BR:bna01007]
 Aminotransferase (transaminase)
  Class IV
   106362401
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 106362401
NCBI-ProteinID: XP_013657748
LinkDB
Position
A8:complement(26599971..26602276)
AA seq 383 aa
MFKAISSLRKSLVLPLHSNIRTLQTFSKYNAQAASALREKPLYQDDEYADVDWDNLGFGL
TPADYMYVMKCSKDGEFTQGELSRFGNIQLSPSAGVLNYGQAIYEGTKAYRKENGKLLLF
RPDHNAVRMQLGAERMLIPSPSVDQFVDAVKQTAYANKRWVPPSGKGSLYIRPLLMGSGP
ILGLGPSPEYTFIVYASPVGNYFKEGIAALNLYVEEEYVRAAPGGAGGVKSITNYAPVLK
ALSRAKSRGFSDVLYLDSVKKKYLEEASSCNVFVVKGRTISTPATNGTILEGVTRKSVME
IASDQGYEVVEKSVHVDEVMEADEVFCTGTAVGVAPVGTITYQDKRVEYETGDESVCQKL
RSVLVGIQTGSIEDTKGWVTCIN
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgtttaaagcaatctcatctctgcgcaaaagtctggttctacctcttcattcaaatatt
cgtacgctacaaactttctctaagtacaacgcacaagctgcttcagccttgcgagagaaa
cctctttatcaagatgatgagtatgctgatgtggactgggacaatcttgggtttggtcta
actccagctgattacatgtacgtcatgaaatgctcaaaagacggtgagttcactcaaggt
gaactcagtcgctttggcaatattcagctgagtccttctgctggtgtcttaaactacgga
caggcaatttatgaaggtacaaaagcatataggaaagaaaatgggaagcttcttctgttt
cgccctgatcacaacgctgtccgaatgcagcttggtgctgaacggatgctcataccttct
ccttcggttgatcagtttgttgatgcagttaaacaaaccgcttatgcaaataaacgttgg
gttcctccttcagggaaaggttctttgtacattaggcctctgttgatgggaagtggtcct
attcttggtttaggaccttcacctgaatatacattcattgtctatgcatctcctgttggt
aactacttcaaggaaggtattgctgctttaaacctctatgttgaggaagagtatgtccgg
gcagctcctggtggagctggaggagtcaagagcatcacaaactatgcaccagttttgaaa
gcactgagtagagccaagagccgtgggttttcagacgttctttatcttgattctgttaag
aagaagtatcttgaggaagcttcttcttgcaacgtctttgttgtaaagggtcggacaatc
tcaactcctgcaaccaatgggacaatcctcgagggggttactcggaaaagtgtgatggag
atcgccagtgatcaaggttatgaggtagtagagaagtcagttcatgtggatgaagtgatg
gaagcagatgaagttttctgcactggaactgctgtaggagttgctcctgtgggcactata
acgtatcaggacaaaagagtagagtatgaaaccggggatgaatctgtctgccagaaactg
cgttcggttcttgtcggtattcagacaggatcgattgaagataccaaaggatgggtcaca
tgtatcaactga

KEGG   Brassica napus (rape): 106380604
Entry
106380604         CDS       T04128                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 3, chloroplastic isoform X1
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
bna  Brassica napus (rape)
Pathway
bna00270  Cysteine and methionine metabolism
bna00280  Valine, leucine and isoleucine degradation
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
bna01240  Biosynthesis of cofactors
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    106380604
   00280 Valine, leucine and isoleucine degradation
    106380604
   00290 Valine, leucine and isoleucine biosynthesis
    106380604
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106380604
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106380604
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bna01007]
    106380604
Enzymes [BR:bna01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     106380604
Amino acid related enzymes [BR:bna01007]
 Aminotransferase (transaminase)
  Class IV
   106380604
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 106380604
NCBI-ProteinID: XP_013675851
LinkDB
AA seq 418 aa
MERATLSPSLNQSYLLSPSRASTTRLHSFSFTRNLSPSTSSIKLQPSSSSVSSSFINGGV
SLTRCNAVLSNSSSSTDASEVADIDWDNIGFGLKPTDYMYVMKCNLGGEFSNGELQRFGN
IEVSPSAGVLNYGQGLFEGMKAYRKQDGKNILLFRPEENATRMRCGAERMCMPAPTIDQF
VEAVKATVLANKRWVPPPGKGSLYIRPLLMGTGAVLGLAPAPEYTFLVYVSPVGNYFKEG
VSPINLIVESEFHRATPGGTGGVKTIGNYAAVLKAQSVAKAKGYSDVLYLDCIYKRYLEE
VSSCNIFIVKDNVVSTPEIRGTILPGITRKSIVDVARSQGLKVEERNVTVDELLEADEVF
CTGTAVVVSPVGSITYKGKRVSYGEGSFGSVSEKLYTVLTSLQMGLTEDNMKWTVNLS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggagagagctacactttccccgagtcttaatcaaagttacctgctttctccttcacgc
gcctccaccacgcgcctccattcattctccttcactcggaacttatcgccatcaacttcc
tccatcaagcttcagccttcttcttcctctgtctcttcaagtttcatcaatggcggagtc
tctcttactcggtgcaacgccgtcctgtcaaactcttcttccagtacggatgcgtctgag
gtagccgacatagattgggacaacatcgggttcggtcttaagccgaccgattacatgtac
gtcatgaaatgtaaccttgggggtgagttctctaatggtgagttgcaacgttttgggaac
attgaagtcagcccatctgctggtgtactcaactacggacaggggttgttcgaagggatg
aaagcttacagaaagcaagacggtaagaatatcctcctcttccgtcctgaagagaatgct
acacgtatgagatgtggtgctgagaggatgtgtatgcctgctcctaccattgaccagttt
gtcgaagctgtgaaagcaactgttttagcaaataaacgttgggttccacccccaggtaaa
ggttccttgtacattagaccgttgctaatgggaactggagctgttcttggtcttgctcct
gcaccagaatatactttccttgtctatgtctctcctgttggaaactacttcaaagaaggt
gtgtcaccaatcaatttgattgtggaaagtgaatttcaccgtgcgacacctggtggtacg
ggaggtgttaaaaccattggcaattatgctgcagttttaaaagcacagtcggtggcaaaa
gccaaaggatattcagatgttttgtaccttgattgcatttacaaaagatatcttgaggag
gtctcctcatgcaatatcttcattgtcaaggacaatgtggtctctactcctgaaataaga
ggaaccatcttaccagggattacgcggaaaagtatagttgacgttgctcgtagccaaggg
cttaaggtggaggaacggaatgtgacagtggatgagttactagaggcggacgaggttttc
tgcactggaaccgctgtggttgtctctcccgttggaagcattacttacaaaggcaaaaga
gtatcgtacggagaaggtagctttggatctgtctcggagaaactctataccgttctgaca
agcttgcaaatgggtctgactgaggataacatgaaatggactgtgaatctcagttga

DBGET integrated database retrieval system