KEGG   Brassica napus (rape): 106346190
Entry
106346190         CDS       T04128                                 
Name
(RefSeq) threonine dehydratase biosynthetic, chloroplastic-like
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
bna  Brassica napus (rape)
Pathway
bna00260  Glycine, serine and threonine metabolism
bna00290  Valine, leucine and isoleucine biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    106346190
   00290 Valine, leucine and isoleucine biosynthesis
    106346190
Enzymes [BR:bna01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     106346190
SSDB
Motif
Pfam: PALP Thr_dehydrat_C
Other DBs
NCBI-GeneID: 106346190
NCBI-ProteinID: XP_013640905
LinkDB
Position
A1:34399159..34402441
AA seq 607 aa
MDSVRLPTAPSSLRSQMLGQPLHRIPLPPCNGRSNLRFKPVIGTNLSRENHVSPVAVITR
DETSVAPLASPQPRLKVSPSSLQYPAGYLGAVPERASDPENGSIAEAMEYLTNILSTKVY
DVAIESPLHLAKKLSERLGVRLFLKREDLQPVFSFKLRGAYNMMVKLPAEQLAKGVICSS
AGNHAQGVALSAAKLGCTAVIVMPRTTPEIKWQSVENLGATVVLVGDSYDEAQAFAKQRA
EEEGLTFIPPFDHPDVIAGQGTVGMEITRQAKGPLHAIFVPIGGGGLIAGIASYVKRVCP
EVKIIGVEPADANTMALSLHHGERVILDQVGGFADGVAVKVVGEETFRISRKLVDGVVLV
TRDAICASIKDMFEEQRNILEPAGALAIAGAEAYCKYYGLKDVNVVAITSGANMNFDKLR
IVTELANVGRQQEAVLATILPEKPGSFKKFCELVGAMNITEFKYRCGSEKESVVLYSVGV
HTPGELKALEKRMESSQLRTRNLTSSDLVKDHLRYLMGGRSSVEEEVLCQFTFPERPGAL
MNFLDSFSPRWNISLFHYRAEGGAGANVLVGIQVPEQEMEEFRNRAQVLGYEYVLVSEDT
VFKLLMH
NT seq 1824 nt   +upstreamnt  +downstreamnt
atggattccgtcaggcttccaacggctccttcctctctccgtagccaaatgctaggtcaa
ccccttcaccgcattcccctacctccctgtaacggccgcagcaacctccggtttaaaccg
gttattggaaccaatctatctcgagaaaaccacgtctctccggttgccgttatcacccga
gacgaaacatcagtggctcctctcgcttctcctcagccacgtctcaaggtctctccgagc
tcgctccagtaccccgccggttacctcggcgcggttccggagcgtgcgagcgatcccgag
aacgggagcatcgcggaggcgatggagtatttgacgaatatactgtccactaaggtttac
gacgtggcgattgagtcgccactccacttggccaagaagctatcggagaggttaggtgtt
cgcttgtttctcaagagagaagacttgcaacctgtgttctcgtttaagcttcgtggagct
tacaacatgatggtgaagcttccagctgagcagttagcgaaaggagtcatctgctcctca
gctggaaaccatgctcaaggagttgctttgtctgccgccaaactcggctgcaccgccgtg
attgttatgcctcgcacaactccagagatcaagtggcaatctgtggagaatttgggtgct
acggttgttcttgttggggattcgtatgatgaagcacaagcatttgctaagcaacgagct
gaggaagaaggtttgacgtttatacctccgtttgatcaccctgacgttattgccggacaa
gggactgtggggatggagatcacaaggcaagctaagggtccgttacatgctatatttgtc
cccatcggtggtggtggtttgatagctggtattgcttcttacgtgaagagagtttgtcca
gaggtgaagatcattggtgtggagccagcagatgcaaacacaatggcgttgtcgctgcat
cacggcgagagagtgatactagaccaggttgggggttttgcagatggtgtagcagtcaaa
gtagttggggaagagacttttcgtatatccagaaagctggtggatggtgttgtactcgtc
actcgtgatgctatctgtgcatcgataaaggatatgtttgaggagcaacggaacattttg
gaaccagcaggtgcgcttgcgatcgctggagctgaagcgtactgtaaatattatgggcta
aaggacgtgaatgttgtggccataaccagtggtgcaaacatgaacttcgacaagctgagg
attgtgacggagctggctaatgtcggtagacaacaggaggctgttcttgctactatcttg
ccggaaaagcctggaagctttaagaaattctgtgaactggttggggcaatgaacataacc
gagttcaagtatagatgtgggtctgaaaaggaatctgttgtactatacagtgttggagtg
cacacaccaggagagctcaaagcactagagaagagaatggaatcttctcagctcagaact
aggaaccttacaagcagtgacttagttaaagatcacctgcgttacttgatgggtggaaga
tcaagtgttgaagaagaggttctatgccaattcaccttcccagagagaccaggtgctctg
atgaacttcttggactctttcagtcctcgttggaacattagccttttccattaccgtgca
gagggtggggcaggtgcaaatgtgctggtcgggatccaagtgccggaacaagaaatggag
gagttcagaaaccgagctcaagttcttggatacgagtacgtcttggtaagtgaagacaca
gttttcaagcttctaatgcactga

KEGG   Brassica napus (rape): 106349704
Entry
106349704         CDS       T04128                                 
Name
(RefSeq) threonine dehydratase biosynthetic, chloroplastic
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
bna  Brassica napus (rape)
Pathway
bna00260  Glycine, serine and threonine metabolism
bna00290  Valine, leucine and isoleucine biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    106349704
   00290 Valine, leucine and isoleucine biosynthesis
    106349704
Enzymes [BR:bna01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     106349704
SSDB
Motif
Pfam: PALP Thr_dehydrat_C
Other DBs
NCBI-GeneID: 106349704
NCBI-ProteinID: XP_013645133
LinkDB
Position
A1:34412330..34414551
AA seq 475 aa
MYEFEATFKCVSVWLMMVQVFSFKLRGAYNMMVKLPAEQLAKGVICSSAGNHAQGVALSA
AKLGCTAVIVMPRTTPEIKWQSVENLGATVVLVGDSYDEAQAFAKQRAEEEGLTFIPPFD
HPDVIAGQGTVGMEITRQAKGPLHAIFVPIGGGGLIAGIASYVKRVCPEVKIIGVEPADA
NTMALSLHHGERVILDQVGGFADGVAVKVVGEETFRISRKLVDGVVLVTRDAICASIKDM
FEEQRNILEPAGALAIAGAEAYCKYYGLKDVNVVAITSGANMNFDKLRIVTELANVGRQQ
EAVLATILPEKPGSFKKFCELVGAMNITEFKYRCGSEKESVVLYSVGVHTPGELKELEKR
MESSQLRTRNLTSSDLVKDHLRYLMGGRSSVEEEVLCQFTFPERPGALMNFLDSFSPRWN
ISLFHYRAEGGAGANVLVGIQVPEQEMVEFRNRAQVLGYEYVLVSEDTVFKLLMH
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgtatgaatttgaggctacgtttaagtgtgtatctgtgtggttgatgatggttcaggtg
ttctcgtttaagcttcgtggagcttacaacatgatggtgaagcttccagctgagcagtta
gcgaaaggagtcatctgctcctcagctggaaaccatgctcaaggagttgctttgtctgcc
gccaaactcggctgcaccgccgtgattgttatgcctcgcacaactccagagatcaagtgg
caatctgtggagaatttgggtgcgacggttgttcttgttggggattcgtatgatgaagca
caagcatttgctaagcaacgagctgaggaagaaggtttgacgtttatacctccgtttgat
caccctgacgttattgccggacaagggactgtcgggatggagatcacaaggcaagctaag
ggtccgttacatgctatatttgtccccatcggtggtggtggtttgatagctggtattgct
tcttacgtgaagagagtttgtccagaggtgaagataattggtgtagagccagctgatgcg
aatacaatggcgttgtcgctgcaccacggggagagagtgatactagaccaggttggtggt
tttgcagatggtgtagcggttaaagtagttggcgaagagacttttcgtatatccagaaag
ctggtggatggtgttgtactcgtcactcgtgatgctatctgtgcatcaataaaggatatg
tttgaggagcaacggaacattttggaaccagcaggtgcgcttgcgatcgctggagctgaa
gcgtactgtaaatattatgggctaaaggacgtgaatgttgtggccataaccagtggtgca
aacatgaacttcgacaagctgaggattgtgacggagctggctaatgtcggtagacaacag
gaggctgttcttgctactatcttgccggaaaagcctggaagctttaagaaattctgtgaa
ctggttggggcaatgaacataaccgagttcaagtatagatgtgggtctgaaaaggaatct
gttgtactatacagtgttggagtgcacacacccggagagctcaaagaactagagaagaga
atggaatcttctcagctcagaactaggaacctcacaagcagtgacttagtaaaagatcac
ctgcgttacttgatgggtggaagatcaagtgttgaagaagaggttctatgccaattcacc
ttcccagagagaccaggtgctctgatgaacttcttggactctttcagtcctcgctggaac
attagccttttccattaccgtgcagagggtggggcaggtgcaaatgtgctggtcgggatc
caagtgccggagcaagaaatggtggagttcagaaaccgagctcaagttcttggatacgag
tacgtcttggtaagtgaagacacagttttcaagcttctaatgcactga

KEGG   Brassica napus (rape): 106388975
Entry
106388975         CDS       T04128                                 
Name
(RefSeq) threonine dehydratase biosynthetic, chloroplastic
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
bna  Brassica napus (rape)
Pathway
bna00260  Glycine, serine and threonine metabolism
bna00290  Valine, leucine and isoleucine biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    106388975
   00290 Valine, leucine and isoleucine biosynthesis
    106388975
Enzymes [BR:bna01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     106388975
SSDB
Motif
Pfam: PALP Thr_dehydrat_C
Other DBs
NCBI-GeneID: 106388975
NCBI-ProteinID: XP_013684608
LinkDB
Position
C3:36132527..36135905
AA seq 445 aa
MMVKLTSEQLAKGVICSSAGNHAQGVAMSAAKLGCTAVIVMPRTTPEIKWQSVEDLGATV
VLVGDSYDEAQAFAKQRAEEEGLTFIPPFDHPDVIAGQGTVGMEITRQAKGPLHAIFVPI
GGGGLIAGIASYVKRVCPEVKIIGVEPADANTMALSLHHRERVILDQVGGFADGVAVKEV
GKETFRICQNLVDGVVLVTRDAICASIKDMFEEQRNILEPAGALALAGGEAYCKYYGLKD
VNVVAITSGANMNFDKLRIVTELANVGRQQEAVLATLLPEKPGSFKQFCELIGPMNITEF
KYRCGSEKESVVLYSVGMHTAGELKALEKRMESSQLRTRNLTTSDLVKDHLRYLMGGRSS
VEEEVLCRFTFPERPGALMNFLDSFSPRWNISLFHYRAEGGAGANVLVGIQVSDQEIEEF
RNRAQVLGYEYVLVSEDAIFNLLMH
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgatggtgaagctgacatcagagcaattagcaaaaggggttatctgctcctcagctgga
aaccatgctcaaggagtggctatgtccgctgctaagctcggctgcaccgccgtgattgtt
atgcctcgtacaacccctgaaataaagtggcaatctgtggaggacttgggtgcaacagtt
gttcttgttggggattcgtatgatgaagcacaagcatttgcgaagcaacgagctgaggaa
gaaggtttgacttttatacctccttttgatcaccctgatgttattgccggacaagggacg
gttggaatggagatcacacgacaagctaaaggtccattacatgctatctttgtccccatt
ggtggtggtggtttgatagctggtattgcttcttatgtaaagagagtttgtcctgaggtg
aagatcattggtgtagagccagcggatgcaaatacaatggcgttgtcgttgcatcaccgc
gagagagtgatactagaccaggttggtggctttgcagatggtgtagcagttaaagaagta
ggcaaagagacttttcgtatatgccaaaatcttgtggatggtgttgttcttgtcactcgt
gatgctatttgtgcatcaataaaggatatgtttgaggagcaaaggaacatattagaacca
gcaggtgctcttgcgctcgctggaggtgaagcatactgtaaatattatggcctaaaggac
gtgaatgtcgtagccataaccagtggtgcaaacatgaactttgataagctacggattgtg
acggaactagccaatgtcggtaggcaacaggaggctgttcttgctactctcttgccggaa
aagcctggaagttttaagcagttctgtgaattgattggaccaatgaatataaccgagttc
aagtatagatgtggctcggaaaaggaatctgttgtactatacagtgttggaatgcacaca
gccggagagcttaaagcactagagaagagaatggaatcttctcaactcagaactaggaac
ctcaccaccagtgacttagttaaagatcacctgcgttacttgatgggtggaagatcaagt
gttgaagaagaggttctgtgccgattcaccttccctgagagacccggtgctctgatgaac
ttcttggactctttcagtccacgttggaacattagccttttccattaccgtgcagagggt
ggagcaggggcgaacgtgctggtggggatccaagtctcggaccaagaaattgaggaattt
cgaaaccgagctcaagttcttggatacgagtacgtcttggtaagtgaagacgccatcttc
aaccttctaatgcactga

KEGG   Brassica napus (rape): 106410269
Entry
106410269         CDS       T04128                                 
Name
(RefSeq) threonine dehydratase biosynthetic, chloroplastic
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
bna  Brassica napus (rape)
Pathway
bna00260  Glycine, serine and threonine metabolism
bna00290  Valine, leucine and isoleucine biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    106410269
   00290 Valine, leucine and isoleucine biosynthesis
    106410269
Enzymes [BR:bna01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     106410269
SSDB
Motif
Pfam: PALP Thr_dehydrat_C PAC4
Other DBs
NCBI-GeneID: 106410269
NCBI-ProteinID: XP_013706217
UniProt: A0A078J8M9
LinkDB
Position
A6:complement(26781123..26784337)
AA seq 605 aa
MDSVRLPTAPSSLRSQTLGHLLPHRLRHIPLPPCTSKPLIAMITRSRNRVSPIAVLSGNE
TSISPPDSPPPRLKVNPSSLQYPAGYLGAVPDRASDPENGSITEAMEYLTSILSTKVYDV
AIETPLHLAKKLSERLGVSMFLKREDLQPVFSFKIRGAYNMMAKLPSEQLAKGVICSSAG
NHAQGVAMSAAKLGCTAVIVMPRTTPEIKWQSVEDLGATVVLVGDTYDEAQAFAKQRAEE
EGLTFIPPFDHPDVIAGQGTVGMEITRQAKGPLHAIFVPIGGGGLIAGIAAYVKRVSPEV
KIIGVEPADANSMALSLHHGERVILNQIGGFADGVAVKEVGEETFRICRKLMDGVVLVTR
DAMCASIKDMFEEKRNILEPAGALAIAGAEAYCKYYGLKDVNVVAITSGANMNFDKLRIV
TELANVGRQQEAVLATILPEKPGSFKQFCELVGPMNITEFKYRCGSRKEAVVLYSVGVHT
PGELKALEKRMESSQLKTTNLTTSDLVKDHLRYLMGGRSSVENEVLCRFIFPERPGALMK
FLDSFSPRWNISLFHYRAEGAAGANVLVGIQVPENEIEEFRNRAQVLGYEYVLVSEDINF
KLLMQ
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggattccgtcaggcttccaacggctccttcctccctccgctcccaaacgctaggtcac
ctcttaccccatcgcctccgccacattccgctacctccttgcacatcgaaaccgctgatc
gcgatgatcactcgatctcgcaaccgcgtctctccgatcgccgtcctctccggaaacgaa
acgtccatatctccgccggattctcctccgccgcgtctcaaggtcaatccgagctctctg
cagtaccccgccggctacctcggcgcggttccggaccgcgcgagcgatccggagaacggg
agcatcaccgaggcgatggagtatctgacgagcatactctcgacgaaggtctacgacgtc
gcgatcgagactccgctccacttggccaagaagctatcggagaggcttggcgtttcgatg
tttctcaagagagaagacttgcaacctgtgttctcgtttaagattcgcggagcttacaat
atgatggcgaagcttccatcggagcagttagcgaaaggtgtcatctgctcctcagctgga
aaccatgctcaaggagttgctatgtctgctgctaagctcggctgcaccgccgtgattgtt
atgcctcgtaccacccctgagatcaagtggcaatctgtggaggatttgggtgcaacggtt
gttcttgttggtgatacgtatgatgaagcacaagcatttgctaagcaacgagctgaagaa
gaaggtttgacgtttatacctccttttgatcatccggatgttattgccggacaagggact
gtcgggatggagatcacaaggcaagctaaaggtccattgcatgctatatttgtccccatc
gggggtggtggtttgatagctggtattgctgcctacgtgaagagagtttctcccgaggtg
aagatcattggtgtagaaccagctgatgcaaattcaatggcgttatctctgcatcacggc
gagagagtgatattaaaccagattggtggttttgcagatggtgtagcagttaaagaagtt
ggcgaagagacttttcgtatatgcagaaagctgatggatggtgttgttctcgtcactcgt
gatgctatgtgtgcatcaataaaggatatgtttgaggagaaacggaacatattagaacca
gcaggtgctcttgcgatcgctggagctgaagcgtactgtaaatattatggcctaaaggac
gtgaacgttgtagccataaccagtggtgcaaacatgaactttgacaagctcaggattgtg
acggaactcgccaatgtcggtaggcaacaggaggctgttcttgctactatcttgccggaa
aagcctggaagctttaagcaattttgtgaattggttggaccaatgaacataaccgagttc
aagtatagatgtggctcgagaaaggaagctgttgtactatacagtgttggagtgcacaca
cccggagagctcaaagcactagagaagagaatggaatcttctcaactcaaaactacgaac
cttacaaccagtgacttagtaaaagatcacctgcgttacttgatgggtggaagatcaagt
gttgaaaacgaggttctatgccgattcatattcccggagagaccaggtgctcttatgaag
ttcttggactctttcagtccacggtggaacattagccttttccattaccgtgcagagggt
gctgcgggcgccaacgtgctggtcgggatccaagtcccggagaatgaaatagaggaattt
cgaaaccgagctcaagttcttggatacgagtacgtcttggtaagtgaggacatcaatttc
aagcttttgatgcagtga

KEGG   Brassica napus (rape): 106427957
Entry
106427957         CDS       T04128                                 
Name
(RefSeq) threonine dehydratase biosynthetic, chloroplastic-like
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
bna  Brassica napus (rape)
Pathway
bna00260  Glycine, serine and threonine metabolism
bna00290  Valine, leucine and isoleucine biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    106427957
   00290 Valine, leucine and isoleucine biosynthesis
    106427957
Enzymes [BR:bna01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     106427957
SSDB
Motif
Pfam: PALP Thr_dehydrat_C
Other DBs
NCBI-GeneID: 106427957
NCBI-ProteinID: XP_013724133
LinkDB
Position
A1:34454639..34457930
AA seq 607 aa
MDSVRLPTAPSSLRSQMLGQPLHRIPLPPCNGRSNLRFKPVIGTNLSRKNHVSPVAVITR
DETSVAPLASPQPRLKVSPSSLQYPAGYLGAVPERASDPENGSIAEAMEYLTNILSTKVY
DVAIESPLHLAKKLSERLGVRLFLKREDLQPVFSFKLRGAYNMMVKLPAEQLAKGVICSS
AGNHAQGVALSAAKLGCTAVIVMPRTTPEIKWQSVENLGATVVLVGDSYDEAQAFAKQRA
EEEGLTFIPPFDHPDVIAGQGTVGMEITRQAKGPLHAIFVPIGGGGLIAGIASYVKRVCP
EVKIIGVEPADANTMALSLHHGERVILDQVGGFADGVAVKVVGEETFRISRKLVDGVVLV
TRDAICASIKDMFEEQRNILEPAGALAIAGAEAYCKYYGLKDVNVVAITSGANMNFDKLR
IVTELANVGRQQEAVLATILPEKPGSFKKFCELVGAMNITEFKYRCGSEKESVVLYSVGV
HTPGELKALEKRMESSQLRTRNLTSSDLVKDHLRYLMGGRSSVEEEVLCQFTFPERPGAL
MNFLDSFSPRWNISLFHYRAEGGAGANVLVGIQVPEQEMEEFRNRAQVLGYEYVLVSEDT
VFKLLMH
NT seq 1824 nt   +upstreamnt  +downstreamnt
atggattccgtcaggcttccaacggctccttcctctctccgtagccaaatgctaggtcaa
ccccttcaccgcattcccctacctccctgtaacggccgcagcaacctccggtttaaaccg
gttattggaaccaatctatctcgaaaaaaccacgtctctccggttgccgttatcacccga
gacgaaacatcagtggctcctctcgcttctcctcagccacgtctcaaggtctctccgagc
tcgctccagtaccccgccggttacctcggcgcggttccggagcgtgcgagcgatcccgag
aacgggagcatcgcggaggcgatggagtatttgacgaatatactgtccactaaggtttac
gacgtggcgattgagtcgccactccacttggccaagaagctatcggagaggttaggtgtt
cgcttgtttctcaagagagaagacttgcaacctgtgttctcgtttaagcttcgtggagct
tacaacatgatggtgaagcttccagctgagcagttagcgaaaggagtcatctgctcctca
gctggaaaccatgctcaaggagttgctttgtctgccgccaaactcggctgcaccgccgtg
attgttatgcctcgcacaactccagagatcaagtggcaatctgtggagaatttgggtgct
acggttgttcttgttggggattcgtatgatgaagcacaagcatttgctaagcaacgagct
gaggaagaaggtttgacgtttatacctccgtttgatcaccctgacgttattgccggacaa
gggactgtggggatggagatcacaaggcaagctaagggtccgttacatgctatatttgtc
cccatcggtggtggtggtttgatagctggtattgcttcttacgtgaagagagtttgtcca
gaggtgaagatcattggtgtggagccagcagatgcaaacacaatggcgttgtcgctgcat
cacggcgagagagtgatactagaccaggttgggggttttgcagatggtgtagcagtcaaa
gtagttggggaagagacttttcgtatatccagaaagctggtggatggtgttgtactcgtc
actcgtgatgctatctgtgcatcgataaaggatatgtttgaggagcaacggaacattttg
gaaccagcaggtgctcttgcgatcgctggagctgaagcgtactgtaaatattatggtctt
aaggacgtgaatgttgttgccataaccagtggtgcaaacatgaactttgacaagctgagg
attgtgacggagctggctaatgtcggtaggcaacaggaggctgttcttgctactatcttg
ccggaaaagcctggaagctttaagaaattctgcgaactggttggggcaatgaacataacc
gagttcaagtatagatgtgggtctgaaaaggaatctgttgtactatacagtgttggagtg
cacacaccaggagagctcaaagcactagagaagagaatggaatcttctcagctcagaact
aggaaccttacaagcagtgacttagttaaagatcacctgcgttacttgatgggtggaaga
tcaagtgttgaagaagaggttctatgccaattcaccttcccagagagaccaggtgctctg
atgaacttcttggactctttcagtcctcgttggaacattagccttttccattaccgtgca
gagggtggggcaggtgcaaatgtgctggtcgggatccaagtgccggaacaagaaatggag
gagttcagaaaccgagctcaagttcttggatacgagtacgtcttggtaagtgaagacaca
gttttcaagcttctaatgcactga

KEGG   Brassica napus (rape): 106439173
Entry
106439173         CDS       T04128                                 
Name
(RefSeq) threonine dehydratase biosynthetic, chloroplastic-like
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
bna  Brassica napus (rape)
Pathway
bna00260  Glycine, serine and threonine metabolism
bna00290  Valine, leucine and isoleucine biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    106439173
   00290 Valine, leucine and isoleucine biosynthesis
    106439173
Enzymes [BR:bna01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     106439173
SSDB
Motif
Pfam: PALP Thr_dehydrat_C
Other DBs
NCBI-GeneID: 106439173
NCBI-ProteinID: XP_013736017
LinkDB
Position
A3:22188320..22202969
AA seq 603 aa
MDSVKLPTAPSSLRTQMSPHHFHHLPLPHRSFRLKPVIGITRSRSHHVSPVAVLFREETS
LAPLDLPLPRLKVSPNSLQYPPGYLGAVPERASDHDNGSIVEAMEYLTNILSTKVYDIAV
ESPLHLAKKLSERLGVRMLLKREDLQPVKSFKLRGAYNMMVKLTSEQLAKGVICSSAGNH
AQGVAMSAAKLGCTAVIVMPRTTPEIKWQSVEDLGATVVLVGDSYDEAQAFAKQRAEEEG
LSFIPPFDHPDVIAGQGTVGMEITRQAKGPLHAIFVPIGGGGLIAGIASYVKRVCPEVKI
IGVEPADANTMALSLHHGERVILDQVGGFADGVAVKEVGKETFRICQNLVDGVVLVTRDA
ICASIKDMFEEQRNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGANMNFDKLRIVTE
LANVGRQQEAVLATLLPEKPGSFKQFCELIGPMNITEFKYRCGSEKESVVLYSVGVHTAG
ELKALEKRMESSQLRTRNLTTSDLVKDHLRYLMGGRSSVEEEVLCQFTFPERPGALMNFL
DSFSPRWNISLFHYRAEGGAGANVLVGIQVSEQEMEEFRNRAQVLGYEYVLVSEDAIFNL
LMH
NT seq 1812 nt   +upstreamnt  +downstreamnt
atggattccgtcaagcttccaacggctccgtcatctctccgcacccaaatgtcaccccat
cacttccaccaccttcctctacctcatcgtagcttccggttaaaaccggttatcggaatc
actcgatctcgtagccaccacgtgtcaccggtggctgttcttttccgcgaagaaacgtct
ttagctccgctggatcttcctctgccacgtctcaaggtctctccgaactctctacagtac
ccgcccggttacctcggcgcggttccggagcgtgcgagcgaccacgataacggaagcatc
gtggaggctatggagtatctgacgaatatactctccacgaaggtttacgacatcgccgtt
gagtcgccacttcacttggctaagaagctgtcggagaggctaggtgttcgtatgcttctc
aaaagagaagacttgcaacctgtgaagtcgtttaagcttcgtggagcttacaacatgatg
gtgaagctgacatcagagcaattagcaaaaggggtgatctgctcctcagctggaaaccat
gctcaaggagtggctatgtccgctgctaagctcggctgcaccgccgtgattgttatgcct
cgtacaacccctgaaatcaagtggcaatctgtggaggacttgggtgcaacagttgttctt
gttggagattcgtatgatgaagcacaagcatttgctaagcaacgagctgaagaagaaggt
ttgagttttatacctccttttgatcaccctgatgttattgccggacaagggacggttggg
atggagatcacacggcaagctaaaggtccattacatgctatctttgtccccattggtggt
ggtggtttgatagctggtattgcttcttatgtgaagagagtttgtcctgaggtgaagatc
attggtgtagagccagcggatgcaaatacaatggcgttgtccttgcatcatggcgagaga
gtgatactagaccaggttggtggctttgcagatggtgtagcagttaaagaagtaggcaaa
gagacttttcgtatatgccaaaatcttgtggatggtgttgttcttgtcactcgtgatgct
atttgtgcatcaataaaggatatgtttgaggagcaaaggaacatattagaaccagcaggt
gctcttgcgctcgctggagctgaagcatattgtaaatactatggcctaaaggatgtgaat
gttgtagccataaccagtggtgcaaacatgaactttgataagctacggattgtgacagaa
ctagccaatgtcggtaggcaacaggaggctgttcttgctactctcttgccggaaaagcct
ggaagttttaagcagttctgtgaattgattggaccaatgaatataaccgagttcaagtat
agatgtggctcggaaaaggaatctgttgtactttacagtgttggagtgcacacagccgga
gagctcaaagcactagagaagagaatggaatcttctcaactcagaactaggaacctcacc
accagtgacttagttaaagatcacctgcgttacttgatgggtggaagatcaagtgttgaa
gaagaggttctatgccaattcaccttccctgagagacccggtgctctgatgaacttcttg
gactctttcagtccacgttggaacattagccttttccattaccgtgcagagggtggagca
ggcgcgaacgtgctggtggggatccaagtctcggagcaagaaatggaggaatttcgaaac
cgagctcaagttcttggatacgagtacgtcttggtgagtgaagacgccatcttcaacctt
ctaatgcactga

DBGET integrated database retrieval system