KEGG   Brassica napus (rape): 106346910
Entry
106346910         CDS       T04128                                 
Name
(RefSeq) 2-isopropylmalate synthase 1, chloroplastic-like
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00620  Pyruvate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106346910
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106346910
Enzymes [BR:bna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     106346910
SSDB
Motif
Pfam: HMGL-like LeuA_dimer
Other DBs
NCBI-GeneID: 106346910
NCBI-ProteinID: XP_013641826
UniProt: A0A078GLN7
LinkDB
Position
A6:10330019..10333468
AA seq 626 aa
MASSILRNPMLSSPTTTIPTPSLPSSSSKPSPLSFRFPPSHHRSSVSLRSQSLRLSCSLS
DPSPPLRRRRPEYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVD
VIEAGFPAASKDDFEAVKTIAETVGNAVDGDGYVPVICGLSRCNKRDIETAWEAVKYAKR
PRIHTFIATSDIHLEYKLKKSKDEVIEIARNMVKFARSLGCEDVEFSPEDAGRSEREFLY
EILGEVIKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTA
NTLSGAHSGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMTS
KMVEDYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIV
LGKLSGRHALKDRLTELGYVLDDEQLSSIFWRFKSVAERKKRVTDADIIALVSDEVFQPE
ALWRLLDIQITCGTLGLSTATVKLVDADGKEHVACSMGAGPVDSAYKAIDLIVKEPATLL
EYSMNAVTEGIDAIATTRVLIRGNNNYSTTNAITGEEVQRTFSGTGAGMDIVVSSVKAYV
GALNKMLDFKENAPTKVPSQNNNVPA
NT seq 1881 nt   +upstreamnt  +downstreamnt
atggcgtcttcgattctcagaaaccctatgctctcatcaccaacaacaacaatccccacc
ccttctcttccctcctcctcctcaaaaccctcacctctctcattccgcttcccaccctcc
caccaccgctcctccgtttccctccgcagccaatccctccgcctctcctgctccctctca
gatccctctcctcccctccgccgccgccgcccggagtacatccccaaccgcatttccgac
cccaactacgtccgagtcttcgacaccactctccgcgacggcgaacagtcccccggagcc
accctcacctccaaggaaaagctcgacatcgcgcgccagctcgcgaagctaggcgtcgac
gtaatcgaggccggcttccccgccgcctccaaggacgacttcgaagccgtcaaaaccata
gccgaaaccgtgggaaacgccgtcgacggagacggttacgtccccgtcatctgcggactc
tcgagatgcaacaagagagatatagagacggcgtgggaggctgtgaagtacgccaaaagg
ccgaggatccataccttcatcgccacgagtgacattcacttggagtataagctgaagaag
agcaaagacgaggtcatcgagatcgctaggaatatggttaagttcgcgaggagcttgggg
tgtgaggacgttgagtttagtcctgaagatgctggaagatcggagagagagtttttgtat
gagattcttggggaagtgataaaagctggagcgacaacgcttaatatacctgacactgtt
ggtataacgttgcctagtgagtttggtcagttgattgctgatattaaagccaatactcct
gggatcgagaatgttatcatctcaacgcattgtcagaatgatcttgggctctccactgcc
aacactttatctggtgcacattcgggtgcaaggcaagtggaagtgactatcaatggcatt
ggggaaagagctggaaacgcttcactagaagaggttgtgatggccataaaatgccgtgga
gatcatgtattaggaggcctatatactggaatcgatactcgccacattgttatgacaagc
aagatggttgaggattacacaggaatgcaaacacagccccataaggctattgtaggagcg
aatgcctttgcgcatgaaagtggtattcatcaggatggaatgctgaaacacaagggcaca
tatgaaattatatgccccgaagaaattggacttgaacgatctaatgatgctggcattgtt
ttggggaagcttagtgggcgtcatgcgttgaaagaccgtttgactgagcttggttatgta
ctagatgatgaacagctaagttccattttctggcgcttcaaatctgtggctgagcggaaa
aagagagttaccgacgcagatataatagctttggtttctgatgaggttttccagccagaa
gccttgtggagactcctggacattcagattacatgtgggactctcggactctcaacagca
accgttaaacttgttgatgctgatggcaaagagcatgttgcctgttctatgggtgctggg
cctgtcgattcagcttataaggcaatcgatcttattgtcaaggaaccagcgactttgctt
gagtactcaatgaatgcggtaacagaaggcatcgatgccattgcaaccacacgagttctt
atccgaggaaataacaattactcaactacaaatgcaatcactggtgaagaagttcaaagg
acctttagtggaaccggagctggaatggacattgtggtgtcgagcgtcaaagcttatgta
ggagctttgaacaaaatgctcgacttcaaagaaaacgccccaacgaaagtcccttctcaa
aacaacaatgtacctgcctga

KEGG   Brassica napus (rape): 106369058
Entry
106369058         CDS       T04128                                 
Name
(RefSeq) 2-isopropylmalate synthase 1, chloroplastic-like
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00620  Pyruvate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106369058
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106369058
Enzymes [BR:bna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     106369058
SSDB
Motif
Pfam: HMGL-like LeuA_dimer Invasin_D3
Other DBs
NCBI-GeneID: 106369058
NCBI-ProteinID: XP_013664610
UniProt: A0A078G8H7
LinkDB
Position
A9:complement(40643763..40646446)
AA seq 466 aa
MASSLLRNPSLSSSTTTPSLPTFSTTITTPLSFRFPPSHHRRRSSSASLRLSCSISDPPP
PLPPHPLPEDAGRSEREFLYEILGEVIKAGATTLNIPDTVGITLPSEFGQLIADIKANTP
GIENVVISTHCQNDLGLSTANTLSGAHAGARQVEVTINGIGERAGNASLEEVVMAIKCRG
DHVLGGLYTGIDTRHIVMTSKMVEDYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGT
YEIICPEEIGLERSNDAGIVLGKLSGRHALKDRLTELGYVLDDEQLSTIFWRFKSVAEQK
KRVTDADIIALVSDEVFQPEAVWKLLDIQITCGTLGLSTATVKLADADGKEHCACSMGTG
PVDSAYKAVDLIVKEPATLLEYSMNAVTEGIDAIATTRVLVRGNNTYTSTNAITGEEVLR
TFSGTGAGMDIVVSSVKAYVGALNKMLDFKEKSPKKVPSRNIKVTA
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggcgtcttcccttctcagaaacccttcactctcatcatcaacaacaacaccttctctc
cccaccttctccacaacaatcaccacaccactctccttccgtttcccaccatcccaccac
cgccgccgctcctcctccgcctccctccgcctctcctgctccatctcagatccaccgccc
cctctccctccccacccccttcctgaagatgcaggaaggtcggagagggagtttttgtat
gagattcttggagaagtgataaaagctggagcgacgacgcttaatattcctgatactgtt
ggtatcactttgcctagtgagtttggtcagttgattgctgatataaaggctaatacccct
gggattgagaacgttgtcatctcgactcattgtcagaatgatcttggactctctaccgcc
aacactttatctggagcacatgcaggtgctaggcaggttgaagtgacgattaatggaatt
ggtgaaagagctggaaacgcttcactagaagaggttgtgatggcaataaaatgccgagga
gatcatgtgttaggaggtctatatactggaattgatactcgccacattgttatgacaagc
aagatggtggaagattacactggaatgcaaacgcagccccataaggctattgtaggagcg
aatgcctttgctcatgaaagtggtattcatcaggatggaatgctgaaacacaagggtacc
tatgaaattatatgccctgaagaaattggacttgagcgatcaaatgatgctggcattgtc
ttagggaagcttagtgggcgccatgcgttgaaagaccgtttgactgagcttggttatgta
ttggacgatgaacagctaagcaccattttctggcgcttcaaatccgtggctgagcagaaa
aagagagttactgatgcggatataatagcgttggtatctgacgaggtgttccagccagaa
gctgtatggaaactactggacattcagataacttgtggaactctggggctttcaacagca
acggtgaaactggctgatgctgatggcaaagagcattgtgcttgttcaatgggaactggc
cctgttgattcagcttataaggcagttgaccttatcgtcaaggaaccggcgactctgctt
gagtactcaatgaatgcagtaacagaaggcattgatgccatagcaactacacgagttctt
gtccgtggaaacaacacttacacatctaccaacgcaataactggcgaagaagttttaagg
accttcagtggaaccggagcgggaatggacattgtggtgtcaagcgtcaaggcttatgta
ggagctcttaacaaaatgctcgatttcaaagagaagtctccgaaaaaagttccttctcga
aacatcaaagtcactgcctga

KEGG   Brassica napus (rape): 106427153
Entry
106427153         CDS       T04128                                 
Name
(RefSeq) 2-isopropylmalate synthase 1, chloroplastic
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00620  Pyruvate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106427153
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106427153
Enzymes [BR:bna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     106427153
SSDB
Motif
Pfam: HMGL-like LeuA_dimer
Other DBs
NCBI-GeneID: 106427153
NCBI-ProteinID: XP_013723340
LinkDB
Position
C5:13854753..13857795
AA seq 580 aa
MASSILRNPMLSSPTTITTPSLPSFSSKPSPLSFRFPPSHHRSSLRIKSLRLSCSLSDPS
PPLRRRRPEYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDVIE
AGFPAASKDDFEAVKTIAETVGNAVDGDGYVPVICGLSRCNKRDIETAWEAVKYAKRPRI
HTFIATSDIHLEYKLKKSKDEVIEIARNMVKFARSLGCEDVEFSPEDAGRSEREFLYQIL
GEVIKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL
SGAHSGARQLEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMTSKMV
EDYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGK
LSGRHALKDRLTELGYVLDDEQLSSIFWRFKSVAERKKRVTDADIIALVSDEVFQPEALW
KLLDIQITCGTLGLSTATVKLADADGKEHVACSMGTGPVDSAYKAVDLVVKEPATLLEYS
MNAVTEGIDAIAATRVLIRGNNNYSTTNAITGEEVQRTFR
NT seq 1743 nt   +upstreamnt  +downstreamnt
atggcgtcttcgattctcagaaaccctatgctctcatcaccaacaacaatcaccacccct
tctcttccctccttctcctcgaaaccctcacctctctcattccgcttcccaccctcccac
caccgctcctccctccgcatcaaatccctccgcctctcgtgctccctctcagatccctct
cctcccctccgccgccgccgcccggagtacatccccaaccgcatttccgaccccaactac
gtccgagtcttcgacaccactctccgcgacggcgaacagtcccccggagccaccctcacc
tccaaggagaagctcgacatcgcgcgccagctcgcgaagctgggcgtcgacgtaatcgag
gccgggttccccgccgcctccaaggacgacttcgaagccgtgaaaaccatagccgaaacc
gtgggaaacgccgtcgacggagacggttacgtccccgtcatctgcggactctcgagatgc
aacaagagagatatcgagacggcgtgggaggctgtgaagtacgccaaaaggccgaggatc
catacgttcatcgccacgagtgacattcacttggagtataagctgaagaagagcaaagac
gaggtcatcgagatcgctaggaatatggtaaagttcgcgaggagcttggggtgtgaggac
gttgagtttagtcctgaagatgcaggaagatcggagagagagtttttgtatcagattctt
ggggaagtgataaaagctggagcgactacgcttaatatacctgacactgttggtataacg
ttgcctagtgagtttggtcagttgattgctgatatcaaagccaatactcctgggatcgag
aatgttatcatctcaacgcattgtcagaatgatcttgggctctccactgccaacacttta
tctggtgcacattcgggtgcaaggcaactggaagtgactatcaatggcattggcgaaaga
gctggaaacgcttcactagaagaggttgtgatggccataaaatgccgtggagatcatgta
ttaggaggcctgtatactggaatcgatactcggcacattgttatgacaagcaagatggtt
gaagattacacaggaatgcaaacacagccccataaggctattgtaggagcgaatgccttt
gcgcatgaaagtggtattcatcaggatggaatgctcaaacacaagggcacatatgaaatt
atatgccccgaagaaattggacttgaacgatctaatgatgctggcattgttttggggaag
cttagtgggcgtcatgcgttgaaagaccgtttgactgagcttggttatgtactagatgat
gaacaactaagttccattttctggcgcttcaaatctgtggctgagcggaaaaagagagtt
accgacgcagatataatagctttggtttctgatgaggttttccagccagaagctctgtgg
aaactcctggacattcagataacttgtgggactttggggctttcaacagcaaccgtgaaa
cttgctgacgctgatggcaaagagcatgttgcttgttctatgggaaccgggcctgtcgat
tcagcttataaggcagtcgatcttgttgtcaaggaaccagcgactctgcttgagtactca
atgaatgcagtaacagaaggcatcgatgccattgcagccacaagagttcttatccgagga
aacaacaattactcaactacaaacgcaatcactggtgaagaagttcaaaggacctttagg
taa

KEGG   Brassica napus (rape): 106436775
Entry
106436775         CDS       T04128                                 
Name
(RefSeq) 2-isopropylmalate synthase 1, chloroplastic-like
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00620  Pyruvate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106436775
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106436775
Enzymes [BR:bna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     106436775
SSDB
Motif
Pfam: HMGL-like LeuA_dimer AP_endonuc_2 Invasin_D3
Other DBs
NCBI-GeneID: 106436775
NCBI-ProteinID: XP_013733174
LinkDB
AA seq 629 aa
MASSLLRNPTLSSSPSLPTFSSTITTTTPLSFRFPPSPHHHHHRRSSSASLRLSCSISDP
PPPLPPHPLRRRRPDYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKL
GVDIIEAGFPAASKDDFEAVKTISETVGNAVDENGYVPVICGLSRCNKKDIQTAWEAVRY
AKRPRIHTFIATSDIHLEYKLKKSKQEVIEIARSMVRFARSLGCDDVEFSPEDAGRSERE
FLYEILGEVIKAGATTLNIPDTVGITLPSEFGQLIADLKANTPGIENVVISTHCQNDLGL
STANTLSGAHAGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIV
MTSKMVEDYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDA
GIVLGKLSGRHALKDRLTELGYVLDDEQLSTIFWRFKSVAEQKKRVTDADIIALVSDEVF
QPEAVWKLLDIQITCGTLGLSTATVKLADADGKEHCACSMGTGPVDSAYKAVDLIVKEPA
TLLEYSMNAVTEGIDAIATTRVLVRGNNTYTSTNAITGEEVLRTFSGTGAGMDIVVSSVK
AYVGALNKMLDFKEKSPKKVPSRNIKVTA
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggcgtcttcccttctcagaaaccctacactctcatcatcaccttctctccccaccttc
tcctcaacaatcaccaccaccacacctctctcgttccgcttcccaccatccccccaccac
caccaccaccgccgctcctcctccgcctccctccgcctctcctgctccatctcagatcca
ccaccccctctcccccctcaccccctccgccgccgccgcccggactacatccccaaccgc
atttccgaccccaactacgtccgcatcttcgacaccaccctccgcgacggcgagcagtcc
cccggcgccacgctcacctccaaggagaagctcgacatcgcgcgccagctcgcgaagctc
ggcgtcgacatcatcgaggccgggttccccgccgcgtccaaagacgacttcgaggcggtc
aagaccatttccgaaaccgtcggaaacgcggtcgacgagaacggttacgtccccgtcatc
tgcggtctctcgaggtgtaacaagaaagatatccagacggcttgggaggctgtgagatac
gccaaacggcctaggatccatacgttcatcgccacgagtgatattcacttggagtataag
ctcaagaagagtaaacaagaagtcatcgagatcgcgaggagcatggttaggttcgctagg
agcttggggtgtgatgacgtggagtttagtcctgaagatgcaggaagatcggagagagag
tttttgtatgagattcttggagaagtgataaaagctggagcgacgacgcttaatattcct
gatactgttggtatcactttgcctagtgagtttggtcagttgattgctgatttaaaggct
aatactcctgggatcgagaacgttgtcatctcgacgcattgtcagaatgatcttggactc
tctaccgccaacactttatctggagcacatgctggtgcgaggcaggtagaagtgaccatc
aatggaattggtgaaagagctggaaacgcttcactggaagaggttgtgatggccataaaa
tgccgtggagatcatgtgttaggaggtctgtttactggcattgatactcggcacattgtt
atgacaagcaagatggtggaagattacactggaatgcaaacgcagccccataaggctatt
gtaggagcgaatgcttttgctcatgaaagtggtattcatcaggatggaatgctgaaacac
aagggtacatatgaaattatatgccctgaagaaattggacttgagcgatcaaatgatgct
ggcattgtcttagggaagcttagtgggcgtcatgcgttgaaagaccgtttgactgagctt
ggttatgtattggatgatgaacagctaagcaccattttctggcgcttcaaatccgtggct
gagcagaaaaagagagttactgatgcggatataatagctttggtatctgacgaggtgttc
cagccagaagctgtatggaaactcctggacattcagataacttgtggaactctggggctt
tcaacagcaacggtgaaacttgctgatgctgatggcaaagagcattgcgcttgttcaatg
ggaactggccctgttgattcagcttataaggcagttgaccttatcgtcaaggaaccggcg
actctgcttgagtactcaatgaatgcagtaacagaaggcattgatgccatagcaactaca
cgagttcttgtccgtggaaacaacacttacacatctacaaacgcaataactggcgaagaa
gttttaaggacctttagtggaaccggagcgggaatggacattgtggtgtcaagcgtcaag
gcttatgtaggagctcttaacaaaatgctcgatttcaaagagaagtctccgaaaaaagtt
ccttctcgaaacatcaaagtcactgcctga

DBGET integrated database retrieval system