KEGG   Brassica napus (rape): 106350897
Entry
106350897         CDS       T04128                                 
Name
(RefSeq) acetolactate synthase 3, chloroplastic-like
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00650  Butanoate metabolism
bna00660  C5-Branched dibasic acid metabolism
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106350897
   00660 C5-Branched dibasic acid metabolism
    106350897
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106350897
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106350897
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     106350897
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_M TPP_enzyme_N
Other DBs
NCBI-GeneID: 106350897
NCBI-ProteinID: XP_013646185
LinkDB
Position
A6:31541826..31543692
AA seq 591 aa
MATITNISTSFYKFHHDHSSSKTLIPVSKLALSFAINPRKPSYIHSRSKHGSLFCSAVLN
SPPEDLSRRGSDILVESLERQGVETVFAYHGSVSTQGVEAAYAYHGDLSRGSTELYRALK
RSSVIRHILSHNVKSPLFAAEGYARSSGKPGICIIAASDRRGGDYLASCLSDTCVPLVAI
TSQYINNDASMRLMTKHIFQVMSAEDIPQIIEEAFFLATSGRPGLVLINLPENIQKCYAV
PSWESYWEQIVSLIKECKKPMLYLGGGCLNSIDELNRFVQLTGIPVTSAIMGLGSYPSHD
DFSLQTFGMQRTVYANHALKECDLLLAFGVGSDEPLPSKAKTVHIDVDASGDSERPLVPV
RVDVKLAFQEMNKILEERADELKLDFKLWRIELKEYKQNTPLSFKPPKEAIPPQFVIQVL
NELTDGNAFITTGTGQHHMWAAQFYKCKKPMHWLASRGFEAMGFGLSAAIGASVANPDEV
VVYIDGDRSFLKNAPYLPTIVTENLNVKILILDNEYIGVSSLEGDMCYKKSFLGDKATTI
LPDMLKVAEICKIPGRRVSRREEVRGAIQTMLDTPGPYVLDVIVPDEREIF
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggcaacgatcacaaatatatcaacctccttctacaaatttcaccatgatcattcctcc
tcaaaaactcttataccagtttcgaaactagctctttcttttgccattaatcctcgaaaa
ccctcctacatccattcccggagcaaacacggttctctcttctgctctgctgttctcaac
tcacctcctgaagacctctcccgcaggggctctgatatcctcgttgagtcccttgaacgt
caaggcgttgaaaccgtcttcgcataccatggatccgtatccacgcaaggcgttgaagca
gcctacgcataccatggagacctctcccgtggatccacggagctctaccgcgcgctcaag
cgctcctccgtgatccgtcacatcctttctcacaacgtaaaaagtcctctttttgcagct
gagggctacgctcggtcctctggaaaacctggaatctgtattatagccgcctccgaccgc
cgcggaggggactatctcgctagctgtctatctgacacttgcgtccctcttgtggccata
accagccaatacattaataacgatgcctcaatgcgtttgatgacaaaacatatatttcaa
gtgatgagtgcggaggatatcccccagatcatcgaggaagccttctttctagctacttcc
ggtcgtcccgggcttgttttgattaatcttccagagaatattcagaaatgttatgctgtt
cccagctgggaatcttactgggagcagattgttagcttgataaaggaatgtaagaaacct
atgttgtatcttggaggtggctgtctgaactccatcgatgaactgaatagatttgtccaa
ctcacgggaatccccgtcacaagtgcaataatgggacttggatcttacccttcccacgat
gatttttcgttacaaacatttggaatgcaaaggacagtgtatgcaaatcacgctttaaaa
gaatgcgatcttttgctagcttttggggttggttcagacgagcctttacctagcaaggct
aaaacagttcatatcgacgtcgacgcatcaggagattctgagagacctcttgtaccagtg
cgcgtagatgttaagttggcttttcaagagatgaacaagattcttgaggaacgagccgat
gagctcaagcttgattttaaactatggaggattgagttgaaagagtataagcaaaacaca
ccgttgagtttcaaaccacctaaagaggccatccctccacagtttgtgattcaagtcctt
aacgagctaaccgatggtaacgcctttataactactggtaccgggcaacatcatatgtgg
gcggcgcagttttacaagtgtaagaagcccatgcactggctagcatcaagaggcttcgaa
gcaatggggtttggactctccgctgccattggagcgtctgttgcaaaccctgatgaggtt
gttgtgtacattgacggagacaggagcttcctaaagaatgcgccgtacttgcctactatc
gtgacagagaatcttaatgtgaagatacttatactagacaacgagtacattggtgtctcc
tccctggagggagatatgtgttacaagaaatcttttctcggtgataaggcgacaacaata
ctacccgatatgctcaaggttgcagaaatttgtaagattccagggaggagagtgtcgagg
agagaagaagtacgaggggctatacagaccatgctcgacacacctggtccatatgtgttg
gatgtgatagttccggatgagagggaaattttttag

KEGG   Brassica napus (rape): 106353715
Entry
106353715         CDS       T04128                                 
Name
(RefSeq) acetolactate synthase 1, chloroplastic
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00650  Butanoate metabolism
bna00660  C5-Branched dibasic acid metabolism
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106353715
   00660 C5-Branched dibasic acid metabolism
    106353715
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106353715
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106353715
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     106353715
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Other DBs
NCBI-GeneID: 106353715
NCBI-ProteinID: XP_013648961
UniProt: P27818 A0A0B5GP95 D3JJ57
LinkDB
Position
C7:34820412..34822655
AA seq 655 aa
MAAATSSSPISLTAKPSSKSPLPISRFSLPFSLTPQKDSSRLHRPLAISAVLNSPVNVAP
PSPEKTDKNKTFVSRYAPDEPRKGADILVEALERQGVETVFAYPGGASMEIHQALTRSST
IRNVLPRHEQGGVFAAEGYARSSGKPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQ
VPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVP
KDIQQQLAIPNWDQPMRLPGYMSRLPQPPEVSQLGQIVRLISESKRPVLYVGGGSLNSSE
ELGRFVELTGIPVASTLMGLGSYPCNDELSLQMLGMHGTVYANYAVEHSDLLLAFGVRFD
DRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMNKVLENRAEELKL
DFGVWRSELSEQKQKFPLSFKTFGEAIPPQYAIQILDELTEGKAIISTGVGQHQMWAAQF
YKYRKPRQWLSSSGLGAMGFGLPAAIGASVANPDAIVVDIDGDGSFIMNVQELATIRVEN
LPVKILLLNNQHLGMVMQWEDRFYKANRAHTYLGDPARENEIFPNMLQFAGACGIPAARV
TKKEELREAIQTMLDTPGPYLLDVICPHQEHVLPMIPSGGTFKDVITEGDGRTKY
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggcggcggcaacatcgtcttctccgatctccttaaccgctaaaccttcttccaaatcc
cctctacccatttccagattctcccttcccttctccttaaccccacagaaagactcctcc
cgtctccaccgtcctctcgccatctccgccgttctcaactcacccgtcaatgtcgcacct
ccttcccctgaaaaaaccgacaagaacaagactttcgtctcccgctacgctcccgacgag
ccccgcaagggtgctgatatcctcgtcgaagccctcgagcgtcaaggcgtcgaaaccgtc
tttgcttatcccggaggtgcttccatggagatccaccaagccttgactcgctcctccacc
atccgtaacgtccttccccgtcacgaacaaggaggagtcttcgccgccgagggttacgct
cgttcctccggcaaaccgggaatctgcatagccacttcgggtcccggagctaccaacctc
gtcagcgggttagcagacgcgatgcttgacagtgttcctcttgtcgccattacaggacag
gtccctcgccggatgatcggtactgacgccttccaagagacgccaatcgttgaggtaacg
aggtctattacgaaacataactatttggtgatggatgttgatgacatacctaggatcgtt
caagaagctttctttctagctacttccggtagacccggaccggttttggttgatgttcct
aaggatattcagcagcagcttgcgattcctaactgggatcaacctatgcgcttacctggc
tacatgtctaggttgcctcagcctccggaagtttctcagttaggtcagatcgttaggttg
atctcggagtctaagaggcctgttttgtacgttggtggtggaagcttgaactcgagtgaa
gaactggggagatttgtcgagcttactgggatccccgttgcgagtactttgatggggctt
ggctcttatccttgtaacgatgagttgtccctgcagatgcttggcatgcacgggactgtg
tatgctaactacgctgtggagcatagtgatttgttgctggcgtttggtgttaggtttgat
gaccgtgtcacgggaaagctcgaggctttcgctagcagggctaaaattgtgcacatagac
attgattctgctgagattgggaagaataagacacctcacgtgtctgtgtgtggtgatgta
aagctggctttgcaagggatgaacaaggttcttgagaaccgggcggaggagctcaagctt
gatttcggtgtttggaggagtgagttgagcgagcagaaacagaagttccctttgagcttc
aaaacgtttggagaagccattcctccgcagtacgcgattcagatcctcgacgagctaacc
gaagggaaggcaattatcagtactggtgttggacagcatcagatgtgggcggcgcagttt
tacaagtacaggaagccgagacagtggctgtcgtcatcaggcctcggagctatgggtttt
ggacttcctgctgcgattggagcgtctgtggcgaaccctgatgcgattgttgtggatatt
gacggtgatggaagcttcataatgaacgttcaagagctggccacaatccgtgtagagaat
cttcctgtgaagatactcttgttaaacaaccagcatcttgggatggtcatgcaatgggaa
gatcggttctacaaagctaacagagctcacacttatctcggggacccggcaagggagaac
gagatcttccctaacatgctgcagtttgcaggagcttgcgggattccagctgcgagagtg
acgaagaaagaagaactccgagaagctattcagacaatgctggatacaccaggaccatac
ctgttggatgtgatatgtccgcaccaagaacatgtgttaccgatgatcccaagtggtggc
actttcaaagatgtaataacagaaggggatggtcgcactaagtactga

KEGG   Brassica napus (rape): 106353716
Entry
106353716         CDS       T04128                                 
Name
(RefSeq) acetolactate synthase 3, chloroplastic
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00650  Butanoate metabolism
bna00660  C5-Branched dibasic acid metabolism
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106353716
   00660 C5-Branched dibasic acid metabolism
    106353716
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106353716
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106353716
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     106353716
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Other DBs
NCBI-GeneID: 106353716
NCBI-ProteinID: XP_013648962
UniProt: P27818 D3JJ57
LinkDB
Position
C7:34825509..34827750
AA seq 655 aa
MAAATSSSPISLTAKPSSKSPLPISRFSLPFSLTPQKDSSRLHRPLAISAVLNSPVNVAP
PSPEKTDKNKTFVSRYAPDEPRKGADILVEALERQGVETVFAYPGGASMEIHQALTRSST
IRNVLPRHEQGGVFAAEGYARSSGKPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQ
VPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVP
KDIQQQLAIPNWDQPMRLPGYMSRLPQPPEVSQLGQIVRLISESKRPVLYVGGGSLNSSE
ELGRFVELTGIPVASTLMGLGSYPCNDELSLQMLGMHGTVYANYAVEHSDLLLAFGVRFD
DRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMNKVLENRAEELKL
DFGVWRSELSEQKQKFPLSFKTFGEAIPPQYAIQILDELTEGKAIISTGVGQHQMWAAQF
YKYRKPRQWLSSSGLGAMGFGLPAAIGASVANPDAIVVDIDGDGSFIMNVQELATIRVEN
LPVKILLLNNQHLGMVMQWEDRFYKANRAHTYLGDPARENEIFPNMLQFAGACGIPAARV
TKKEELREAIQTMLDTPGPYLLDVICPHQEHVLPMIPSGGTFKDVITEGDGRTKY
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggcggcggcaacatcgtcttctccgatctccttaaccgctaaaccttcttccaaatcc
cctctacccatttccagattctcccttcccttctccttaaccccacagaaagactcctcc
cgtctccaccgtcctctcgccatctccgccgttctcaactcacccgtcaatgtcgcacct
ccttcccctgaaaaaaccgacaagaacaagactttcgtctcccgctacgctcccgacgag
ccccgcaagggtgctgatatcctcgtcgaagccctcgagcgtcaaggcgtcgaaaccgtc
tttgcttatcccggaggtgcttccatggagatccaccaagccttgactcgctcctccacc
atccgtaacgtccttccccgtcacgaacaaggaggagtcttcgccgccgagggttacgct
cgttcctccggcaaaccgggaatctgcatagccacttcgggtcccggagctaccaacctc
gtcagcgggttagcagacgcgatgcttgacagtgttcctcttgtcgccattacaggacag
gtccctcgccggatgatcggtactgacgccttccaagagacaccaatcgttgaggtaacg
aggtctattacgaaacataactatttggtgatggatgttgatgacatacctaggatcgtt
caagaagctttctttctagctacttccggtagacccggaccggttttggttgatgttcct
aaggatattcagcagcagcttgcgattcctaactgggatcaacctatgcgcttacctggc
tacatgtctaggttgcctcagcctccggaagtttctcagttaggtcagatcgttaggttg
atctcggagtctaagaggcctgttttgtacgttggtggtggaagcttgaactcgagtgaa
gaactggggagatttgtcgagcttactgggatccccgttgcgagtactttgatggggctt
ggctcttatccttgtaacgatgagttgtccctgcagatgcttggcatgcacgggactgtg
tatgctaactacgctgtggagcatagtgatttgttgctggcgtttggtgttaggtttgat
gaccgtgtcacgggaaagctcgaggctttcgctagcagggctaaaattgtgcacatagac
attgattctgctgagattgggaagaataagacacctcacgtgtctgtgtgtggtgatgta
aagctggctttgcaagggatgaacaaggttcttgagaaccgggcggaggagctcaagctt
gatttcggtgtttggaggagtgagttgagcgagcagaaacagaagttccctttgagcttc
aaaacgtttggagaagccattcctccgcagtacgcgattcagatcctcgacgagctaacc
gaagggaaggcaattatcagtactggtgttggacagcatcagatgtgggcggcgcagttt
tacaagtacaggaagccgagacagtggctgtcgtcatcaggcctcggagctatgggtttt
ggacttcctgctgcgattggagcgtctgtggcgaaccctgatgcgattgttgtggatatt
gacggtgatggaagcttcataatgaacgttcaagagctggccacaatccgtgtagagaat
cttcctgtgaagatactcttgttaaacaaccagcatcttgggatggtcatgcaatgggaa
gatcggttctacaaagctaacagagctcacacttatctcggggacccggcaagggagaac
gagatcttccctaacatgctgcagtttgcaggagcttgcgggattccagctgcgagagtg
acgaagaaagaagaactccgagaagctattcagacaatgctggatacaccaggaccatac
ctgttggatgtgatatgtccgcaccaagaacatgtgttaccgatgatcccaagtggtggc
actttcaaagatgtaataacagaaggggatggtcgcactaagtactga

KEGG   Brassica napus (rape): 106354460
Entry
106354460         CDS       T04128                                 
Name
(RefSeq) acetolactate synthase small subunit 1, chloroplastic
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00650  Butanoate metabolism
bna00660  C5-Branched dibasic acid metabolism
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106354460
   00660 C5-Branched dibasic acid metabolism
    106354460
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106354460
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106354460
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     106354460
SSDB
Motif
Pfam: ALS_ss_C ACT ACT_5 ACT_4 NikR_C
Other DBs
NCBI-GeneID: 106354460
NCBI-ProteinID: XP_013649845
UniProt: A0A816WPK5
LinkDB
Position
A2:5122750..5126835
AA seq 475 aa
MAAATTTAASLACAHFLNQTKVHAFPSKTSVQVSQIIDGRKMRSATLFSAASTDKAITTA
QSVSSTACDRVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAMFTIVVL
GTDKVLQQVVEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPTTRSEIMWLVDIFRAK
VVDTSDHTLTIEVTGDPGKMVALTANLEKFGIKEVARTGKIALRREKMGETAPFWRFSAA
SYPHLVNQSSHEKVAANTKRALTGGNGTASSGGDVYPVEPYNDFKPVLDAHWGVVYDEDS
DGLRSHTLSILVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENI
DKLVRQLQKLIDLHEVQNITHMPFAERELMLIKVAAHTSARRDVLDIAQVFRAKAIDVSD
HTITLEVTGDIRKMAALQTQLEVYGICEVARTGRVALVRESGVDSTYLRGYSLPL
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcggcggctacgaccactgctgcttcactagcctgtgcccacttcttaaatcagacc
aaggtccacgcgtttccgtccaaaacctccgtgcaagtctctcaaatcatcgatgggagg
aagatgagaagtgccactctcttctcagccgcctcaaccgataaagccatcaccactgct
cagtctgtctcgtccactgcatgtgatagagtgaggaggcatacgatctcggtgtttgtg
ggtgacgagagcggtataatcaaccgtatagctggagtgtttgctagaagagggtacaac
attgagtctctagctgtgggattgaacgaagacaaagctatgtttactattgttgttctt
gggacagacaaagtcttgcagcaagttgtagaacagcttaacaaactcgtcaacgtcatc
aaggttgaagatctctccaaggagccgcatgtggaacgtgagttaatgctgattaagctt
aacgctgatccaaccacacgctctgagatcatgtggttggtggatatctttagagcaaaa
gtggtggatacttcggatcacactctgacgattgaggtaactggagacccgggaaagatg
gttgcactaacagcgaacttagagaagtttggaataaaagaagtcgctagaactgggaag
attgctctgagacgggaaaagatgggagaaactgctccattctggagattttcagcagca
tcatacccacacctcgtaaaccaatcatctcatgagaaagttgcagcgaacacaaagcga
gcgttgactggtggaaatggcactgcatcatctgggggtgacgtttatccagtggagcct
tataatgatttcaaaccggtccttgatgctcattggggagtggtctacgatgaagattcg
gatggtcttcggtcacacacattatctatacttgtagccaacgttcctggagttctcaat
ctaataaccggagctatctccaggagaggttataacatccagagtctagcggttggtcct
gctgagaaagagggcttgtctcggatcactacagttatccctggaactgatgaaaacatc
gacaagttggtgaggcagcttcagaagctgattgatcttcatgaggttcaaaatataacc
cacatgccatttgcggagcgagaactgatgctcatcaaagtagctgctcatacttctgca
aggagagatgttctcgatatcgctcaagtgttccgagccaaagccattgatgtctctgat
catactatcactcttgaggttacaggagatatcagaaagatggctgcattacaaacgcag
ttagaggtctacggaatctgcgaggtggctaggacaggaagagtggcattggtcagagaa
tcgggagtggattcgacttaccttcgtggatactctcttcctttgtag

KEGG   Brassica napus (rape): 106355986
Entry
106355986         CDS       T04128                                 
Name
(RefSeq) acetolactate synthase small subunit 1, chloroplastic-like
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00650  Butanoate metabolism
bna00660  C5-Branched dibasic acid metabolism
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106355986
   00660 C5-Branched dibasic acid metabolism
    106355986
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106355986
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106355986
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     106355986
SSDB
Motif
Pfam: ALS_ss_C ACT ACT_5 ACT_4 NikR_C
Other DBs
NCBI-GeneID: 106355986
NCBI-ProteinID: XP_013651293
LinkDB
Position
A2:5118124..5121574
AA seq 437 aa
MAAATTTAASLACAHFLNQTKVHAFPSKTSVQVSQIIDGRKMRSATLFSAASTDKAITTA
QSVSSTACDRVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAMFTIVVL
GTDKVLQQVVEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPTTRSEIMWLVDIFRAK
VVDTSDHTLTIEVTGDPGKMVALTANLEKFGIKEVARTGKIALRREKMGETAPFWRFSAA
SYPHLVNQSSHEKVAANTKRALTGGNGTASSGGDVYPVEPYNDFKPVLDAHWGVVYDEDS
DGLRSHTLSILVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENI
DKLVRQLQKLIDLHEVQNITHIDAAAYYIATADFIGVSRRTRQGIIHLDRNISGIFGRDH
ISPYRFGHGPPMDNVPN
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggcggcggctacgaccactgctgcttcactagcctgtgcccacttcttaaatcagacc
aaggtccacgcgtttccgtccaaaacctccgtgcaagtctctcaaatcatcgatgggagg
aagatgagaagtgccactctcttctcagccgcctcaaccgataaagccatcaccactgct
cagtctgtctcgtccactgcatgtgatagagtgaggaggcatacgatctcggtgtttgtg
ggtgacgagagcggtataatcaaccgtatagctggagtgtttgctagaagagggtacaac
attgagtctctagctgtgggattgaacgaagacaaagctatgtttactattgttgttctt
gggacagacaaagtcttgcagcaagttgtagaacagcttaacaaactcgtcaacgtcatc
aaggttgaagatctctccaaggagccgcatgtggaacgtgagttaatgctgattaagctt
aacgctgatccaaccacacgctctgagatcatgtggttggtggatatctttagagcaaaa
gtggtggatacttcggatcacactctgacgattgaggtaactggagacccgggaaagatg
gttgcactaacagcgaacttagagaagtttggaataaaagaagtcgctagaactgggaag
attgctctgagacgggaaaagatgggagaaactgctccattctggagattttcagcagca
tcatacccacacctcgtaaaccaatcatctcatgagaaagttgcagcgaacacaaagcga
gcgttgactggtggaaatggcactgcatcatctgggggtgacgtttatccagtggagcct
tataatgatttcaaaccggtccttgatgctcattggggagtggtctacgatgaagattcg
gatggtcttcggtcacacacattatctatacttgtagccaacgttcctggagttctcaat
ctaataaccggagctatctccaggagaggttataacatccagagtctagcggttggtcct
gctgagaaagagggcttgtctcggatcactacagttatccctggaactgatgaaaacatc
gacaagttggtgaggcagcttcagaagctgattgatcttcatgaggttcaaaatataacc
cacattgacgctgccgcatattatatcgcgaccgcagattttattggcgtcagccgcagg
acgcggcagggcataatccatttggacagaaatatttcaggcatatttgggcgtgaccat
attagtccatatcgatttggacatgggccgcccatggacaatgtgcccaattga

KEGG   Brassica napus (rape): 106363577
Entry
106363577         CDS       T04128                                 
Name
(RefSeq) acetolactate synthase small subunit 1, chloroplastic isoform X1
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00650  Butanoate metabolism
bna00660  C5-Branched dibasic acid metabolism
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106363577
   00660 C5-Branched dibasic acid metabolism
    106363577
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106363577
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106363577
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     106363577
SSDB
Motif
Pfam: ALS_ss_C ACT ACT_5 ACT_4 NikR_C
Other DBs
NCBI-GeneID: 106363577
NCBI-ProteinID: XP_013663619
LinkDB
Position
C2:4260230..4270273
AA seq 475 aa
MAAATTTAASLACAHFLNQNKAHAFPSKISVQVSQIIDGRKTRSATLFSAASTDKAITTA
QSVSSTACDRVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAMFTIVVL
GTDKVLQQVVEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPTTRSEIMWLVDIFRAK
VVDTSDHTLTIEVTGDPGKMVALTANLEKFGIKEVARTGKIALRREKMGETAPFWRFSAG
SYPHLVNQSSHETVAENTKRALTGGNGTASSGGDVYPVEPYNDFKPVLDAHWGVVYDEDS
DGLRSHTLSILVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENI
DKLVRQLQKLIDLHEVQNITRMPFAERELMLIKVAAHTSARRDVLDIAQVFRAKAIDVSD
HTITLEVTGDIRKMAALQTQLEVYGICEVARTGRVALVRESGVDSTYLRGYSLPL
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcggcggctacgaccactgctgcttcactagcctgtgcccacttcttaaatcagaac
aaggcccacgcgtttccgtccaaaatctccgtgcaagtctctcaaatcatcgacgggagg
aagacgagaagtgccactctcttctcagccgcttccaccgacaaggccatcaccactgct
cagtctgtctcatccactgcatgtgacagagtgaggaggcatacgatctcggtgtttgtg
ggtgacgagagcggtataatcaaccgtatagcgggagtgttcgctagaagagggtacaat
atcgagtctctcgctgtgggattgaacgaagacaaagctatgtttaccatagttgttctt
ggcactgacaaagtcttgcagcaagttgtagaacagcttaacaaactcgtcaacgtcatc
aaggttgaagatctctccaaggagccgcatgtggaacgtgagttaatgctgattaaactt
aacgctgatccaaccacccgctctgagatcatgtggttggtggatatctttagagcaaaa
gtggtggatacttcggatcacactctaacgatcgaggtaactggagacccaggaaagatg
gttgcactaacagcgaacttagagaagtttgggataaaagaagtcgctagaacagggaag
attgctctgagacgggaaaagatgggagaaactgctccgttctggagattttcagctgga
tcatacccacacctcgtaaaccaatcatctcatgagactgttgcagagaatacaaagcga
gcgttgactggtggaaatggcactgcatcatctgggggtgacgtctatccagtggagcct
tataatgatttcaaaccggtccttgacgctcattggggagtggtctacgacgaagattcg
gatggtctgcgctcccacacattatctatacttgtagccaacgttcctggagttctcaat
ttaataaccggagctatctccaggagaggttataacattcagagtctagctgttggtcct
gctgagaaagagggcttgtctcggatcacaacagttatccctggaactgatgaaaacatc
gacaagttggtgaggcagcttcagaagctgattgatcttcatgaggttcaaaatataacc
cgcatgccatttgcggagcgagaactgatgctcatcaaagtagctgctcatacttctgca
aggagagatgttctcgatatcgctcaagtgttccgagctaaagccattgatgtctctgat
catactatcactcttgaggttacaggggatatcagaaagatggctgcattgcaaacgcag
ttagaggtctacggaatctgcgaggtggctaggacaggaagagtggcattggtaagagaa
tctggagtggattcgacttacctccgtggatactctcttcctttgtag

KEGG   Brassica napus (rape): 106366633
Entry
106366633         CDS       T04128                                 
Name
(RefSeq) acetolactate synthase 1, chloroplastic
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00650  Butanoate metabolism
bna00660  C5-Branched dibasic acid metabolism
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106366633
   00660 C5-Branched dibasic acid metabolism
    106366633
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106366633
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106366633
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     106366633
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Other DBs
NCBI-GeneID: 106366633
NCBI-ProteinID: XP_013661739
UniProt: P27818 D3JJ57
LinkDB
AA seq 655 aa
MAAATSSSPISLTAKPSSKSPLPISRFSLPFSLTPQKDSSRLHRPLAISAVLNSPVNVAP
PSPEKTDKNKTFVSRYAPDEPRKGADILVEALERQGVETVFAYPGGASMEIHQALTRSST
IRNVLPRHEQGGVFAAEGYARSSGKPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQ
VPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVP
KDIQQQLAIPNWDQPMRLPGYMSRLPQPPEVSQLGQIVRLISESKRPVLYVGGGSLNSSE
ELGRFVELTGIPVASTLMGLGSYPCNDELSLQMLGMHGTVYANYAVEHSDLLLAFGVRFD
DRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMNKVLENRAEELKL
DFGVWRSELSEQKQKFPLSFKTFGEAIPPQYAIQILDELTEGKAIISTGVGQHQMWAAQF
YKYRKPRQWLSSSGLGAMGFGLPAAIGASVANPDAIVVDIDGDGSFIMNVQELATIRVEN
LPVKILLLNNQHLGMVMQWEDRFYKANRAHTYLGDPARENEIFPNMLQFAGACGIPAARV
TKKEELREAIQTMLDTPGPYLLDVICPHQEHVLPMIPSGGTFKDVITEGDGRTKY
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggcggcggcaacatcgtcttctccgatctccttaaccgctaaaccttcttccaaatcc
cctctacccatttccagattctcccttcccttctccttaaccccacagaaagactcctcc
cgtctccaccgtcctctcgccatctccgccgttctcaactcacccgtcaatgtcgcacct
ccttcccctgaaaaaaccgacaagaacaagactttcgtctcccgctacgctcccgacgag
ccccgcaagggtgctgatatcctcgtcgaagccctcgagcgtcaaggcgtcgaaaccgtc
tttgcttatcccggaggtgcttccatggagatccaccaagccttgactcgctcctccacc
atccgtaacgtccttccccgtcacgaacaaggaggagtcttcgccgccgagggttacgct
cgttcctccggcaaaccgggaatctgcatagccacttcgggtcccggagctaccaacctc
gtcagcgggttagcagacgcgatgcttgacagtgttcctcttgtcgccattacaggacag
gtccctcgccggatgatcggtactgacgccttccaagagacaccaatcgttgaggtaacg
aggtctattacgaaacataactatttggtgatggatgttgatgacatacctaggatcgtt
caagaagctttctttctagctacttccggtagacccggaccggttttggttgatgttcct
aaggatattcagcagcagcttgcgattcctaactgggatcaacctatgcgcttacctggc
tacatgtctaggttgcctcagcctccggaagtttctcagttaggtcagatcgttaggttg
atctcggagtctaagaggcctgttttgtacgttggtggtggaagcttgaactcgagtgaa
gaactggggagatttgtcgagcttactgggatccccgttgcgagtactttgatggggctt
ggctcttatccttgtaacgatgagttgtccctgcagatgcttggcatgcacgggactgtg
tatgctaactacgctgtggagcatagtgatttgttgctggcgtttggtgttaggtttgat
gaccgtgtcacgggaaagctcgaggctttcgctagcagggctaaaattgtgcacatagac
attgattctgctgagattgggaagaataagacacctcacgtgtctgtgtgtggtgatgta
aagctggctttgcaagggatgaacaaggttcttgagaaccgggcggaggagctcaagctt
gatttcggtgtttggaggagtgagttgagcgagcagaaacagaagttccctttgagcttc
aaaacgtttggagaagccattcctccgcagtacgcgattcagatcctcgacgagctaacc
gaagggaaggcaattatcagtactggtgttggacagcatcagatgtgggcggcgcagttt
tacaagtacaggaagccgagacagtggctgtcgtcatcaggcctcggagctatgggtttt
ggacttcctgctgcgattggagcgtctgtggcgaaccctgatgcgattgttgtggatatt
gacggtgatggaagcttcataatgaacgttcaagagctggccacaatccgtgtagagaat
cttcctgtgaagatactcttgttaaacaaccagcatcttgggatggtcatgcaatgggaa
gatcggttctacaaagctaacagagctcacacttatctcggggacccggcaagggagaac
gagatcttccctaacatgctgcagtttgcaggagcttgcgggattccagctgcgagagtg
acgaagaaagaagaactccgagaagctattcagacaatgctggatacaccaggaccatac
ctgttggatgtgatatgtccgcaccaagaacatgtgttaccgatgatcccaagtggtggc
actttcaaagatgtaataacagaaggggatggtcgcactaagtactga

KEGG   Brassica napus (rape): 106366634
Entry
106366634         CDS       T04128                                 
Name
(RefSeq) acetolactate synthase 1, chloroplastic
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00650  Butanoate metabolism
bna00660  C5-Branched dibasic acid metabolism
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106366634
   00660 C5-Branched dibasic acid metabolism
    106366634
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106366634
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106366634
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     106366634
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Other DBs
NCBI-GeneID: 106366634
NCBI-ProteinID: XP_013661740
UniProt: P27818 D3JJ57
LinkDB
AA seq 655 aa
MAAATSSSPISLTAKPSSKSPLPISRFSLPFSLTPQKDSSRLHRPLAISAVLNSPVNVAP
PSPEKTDKNKTFVSRYAPDEPRKGADILVEALERQGVETVFAYPGGASMEIHQALTRSST
IRNVLPRHEQGGVFAAEGYARSSGKPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQ
VPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVDDIPRIVQEAFFLATSGRPGPVLVDVP
KDIQQQLAIPNWDQPMRLPGYMSRLPQPPEVSQLGQIVRLISESKRPVLYVGGGSLNSSE
ELGRFVELTGIPVASTLMGLGSYPCNDELSLQMLGMHGTVYANYAVEHSDLLLAFGVRFD
DRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMNKVLENRAEELKL
DFGVWRSELSEQKQKFPLSFKTFGEAIPPQYAIQILDELTEGKAIISTGVGQHQMWAAQF
YKYRKPRQWLSSSGLGAMGFGLPAAIGASVANPDAIVVDIDGDGSFIMNVQELATIRVEN
LPVKILLLNNQHLGMVMQWEDRFYKANRAHTYLGDPARENEIFPNMLQFAGACGIPAARV
TKKEELREAIQTMLDTPGPYLLDVICPHQEHVLPMIPSGGTFKDVITEGDGRTKY
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggcggcggcaacatcgtcttctccgatctccttaaccgctaaaccttcttccaaatcc
cctctacccatttccagattctcccttcccttctccttaaccccacagaaagactcctcc
cgtctccaccgtcctctcgccatctccgccgttctcaactcacccgtcaatgtcgcacct
ccttcccctgaaaaaaccgacaagaacaagactttcgtctcccgctacgctcccgacgag
ccccgcaagggtgctgatatcctcgtcgaagccctcgagcgtcaaggcgtcgaaaccgtc
tttgcttatcccggaggtgcttccatggagatccaccaagccttgactcgctcctccacc
atccgtaacgtccttccccgtcacgaacaaggaggagtcttcgccgccgagggttacgct
cgttcctccggcaaaccgggaatctgcatagccacttcgggtcccggagctaccaacctc
gtcagcgggttagcagacgcgatgcttgacagtgttcctcttgtcgccattacaggacag
gtccctcgccggatgatcggtactgacgccttccaagagacaccaatcgttgaggtaacg
aggtctattacgaaacataactatttggtgatggatgttgatgacatacctaggatcgtt
caagaagctttctttctagctacttccggtagacccggaccggttttggttgatgttcct
aaggatattcagcagcagcttgcgattcctaactgggatcaacctatgcgcttacctggc
tacatgtctaggttgcctcagcctccggaagtttctcagttaggtcagatcgttaggttg
atctcggagtctaagaggcctgttttgtacgttggtggtggaagcttgaactcgagtgaa
gaactggggagatttgtcgagcttactgggatccccgttgcgagtactttgatggggctt
ggctcttatccttgtaacgatgagttgtccctgcagatgcttggcatgcacgggactgtg
tatgctaactacgctgtggagcatagtgatttgttgctggcgtttggtgttaggtttgat
gaccgtgtcacgggaaagctcgaggctttcgctagcagggctaaaattgtgcacatagac
attgattctgctgagattgggaagaataagacacctcacgtgtctgtgtgtggtgatgta
aagctggctttgcaagggatgaacaaggttcttgagaaccgggcggaggagctcaagctt
gatttcggtgtttggaggagtgagttgagcgagcagaaacagaagttccctttgagcttc
aaaacgtttggagaagccattcctccgcagtacgcgattcagatcctcgacgagctaacc
gaagggaaggcaattatcagtactggtgttggacagcatcagatgtgggcggcgcagttt
tacaagtacaggaagccgagacagtggctgtcgtcatcaggcctcggagctatgggtttt
ggacttcctgctgcgattggagcgtctgtggcgaaccctgatgcgattgttgtggatatt
gacggtgatggaagcttcataatgaacgttcaagagctggccacaatccgtgtagagaat
cttcctgtgaagatactcttgttaaacaaccagcatcttgggatggtcatgcaatgggaa
gatcggttctacaaagctaacagagctcacacttatctcggggacccggcaagggagaac
gagatcttccctaacatgctgcagtttgcaggagcttgcgggattccagctgcgagagtg
acgaagaaagaagaactccgagaagctattcagacaatgctggatacaccaggaccatac
ctgttggatgtgatatgtccgcaccaagaacatgtgttaccgatgatcccaagtggtggc
actttcaaagatgtaataacagaaggggatggtcgcactaagtactga

KEGG   Brassica napus (rape): 106380488
Entry
106380488         CDS       T04128                                 
Name
(RefSeq) acetolactate synthase small subunit 2, chloroplastic
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00650  Butanoate metabolism
bna00660  C5-Branched dibasic acid metabolism
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106380488
   00660 C5-Branched dibasic acid metabolism
    106380488
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106380488
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106380488
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     106380488
SSDB
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4 ACT_6 DUF4423
Other DBs
NCBI-GeneID: 106380488
NCBI-ProteinID: XP_013675713
UniProt: A0A078FR81
LinkDB
Position
C4:60893991..60897236
AA seq 487 aa
MAAISTSTPPSLRNLRSACSNSSPALIPLTRVSFPAKISHLSGDKSPNRDNETGKGTERI
VRRVDKRVSDAPLTTPESKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRD
KALFTIVVSGTERVLQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAQIM
WLVDTFRARIVDIAEHALTIEVTGDPGKMIAVERNLRKFQIREIVRTGKIALRREKMGAT
APFWRFSAASYPDLKEQAPASVLRGSKKGAVVPPTEKTTGGDVYPVEEASDLMVHRVLDA
HWGLLTEEDTSGLRSHTLSLLVNDVPGVLNLVTGVFSRRGYNIQSLAVGHAETEGISRIT
TVVPATDESVSKLVQQLYKLVDVHEVHDLTHMPFAERELMLIKIAVNAAARRDVLDIASI
FRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARESGVDSKYLRG
YSFPLTG
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggcggccatttctacaagcacgcccccatcccttcgcaacttgagatcggcgtgttcc
aattcttcgcccgctctcatacccttgactcgtgtatcgttcccggcgaagatttctcac
ctctccggtgataaatctcctaaccgtgacaacgaaacaggaaagggaacagagagaatc
gttagaagggtggacaagagggtctcggatgctccgctgacaactccagaatcaaaggtg
aggaagcataccatttcggtgtttgtcggagacgaaagcgggatgataaataggattgca
ggagtctttgcgaggagaggatacaatatcgagagccttgctgttggtctcaacagagac
aaggctctcttcaccattgttgtctctggcactgaaagggtgcttcagcaggtcattgag
cagcttcagaagctcgttaatgttctcaaggttgaagatatctcgagcgagccgcaagtg
gagcgtgagttgatgcttgtaaaagttaatgctcatccagaatccagggcacagatcatg
tggctagttgatacattccgagccagaattgtagatattgccgaacatgcattgactatt
gaggtaactggagatcctgggaaaatgattgctgttgaaaggaatttgagaaagtttcag
atcagagagattgtcaggacaggaaagatagcactgagaagggagaagatgggtgctact
gctccattttggcgattttcagcagcgtcctatccagatctcaaggagcaagcacctgct
agtgttcttcgaggtagcaaaaaaggagctgtggttcctccaaccgaaaaaacaacaggg
ggagatgtttatcccgttgaggaagcttctgacctaatggtacatcgtgttcttgacgct
cactggggacttctcaccgaagaagatacgagtggactacggtcacatactctatctttg
cttgtaaacgatgttccaggagtccttaatctcgtaactggtgttttctctcgaagggga
tacaacattcagagcttggctgtaggacatgctgaaacagagggaatttcacgcattaca
acagttgttcctgcgacagatgaatcagtcagcaaattggtgcagcaactttacaaactc
gtagatgtgcatgaggtccatgatcttactcatatgccatttgctgaaagagaactgatg
ctgattaagattgctgtgaacgctgctgcgagaagagatgtcctggacattgctagtatt
ttcagggctaaagctgttgacgtatctgatcatactattactttgcagcttactggggat
cttgacaagatggttgcactgcaaaggttgttggagccctacggtatatgcgaagttgca
agaactgggcgtgtggcattggctcgtgaatcaggagtggactctaagtatcttcgtgga
tactcttttcccttaacaggttaa

KEGG   Brassica napus (rape): 106387990
Entry
106387990         CDS       T04128                                 
Name
(RefSeq) acetolactate synthase small subunit 2, chloroplastic-like
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00650  Butanoate metabolism
bna00660  C5-Branched dibasic acid metabolism
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106387990
   00660 C5-Branched dibasic acid metabolism
    106387990
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106387990
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106387990
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     106387990
SSDB
Motif
Pfam: ALS_ss_C ACT ACT_5 ACT_4 ACT_6 DUF4423
Other DBs
NCBI-GeneID: 106387990
NCBI-ProteinID: XP_022553199
LinkDB
Position
C3:18326907..18333585
AA seq 812 aa
MAAISASSSPSLLSLRSSSPESSPSLTPSTRRVSFPSKISHFSRKSSNRDNETGKRTEQI
VRSVDERVSDAPPTSKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL
FTIVVSGTERVLQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNADPESRAEIMWLV
DTFRAKVVDIAEHALTIEVTGDPGKMIAVERNLKKFEIREIVRTGKIALRREKMGATAPF
WRFSAASYPDLKEQAPVNVLRGSKTGAIVPPSETTAGGDVYPVESTSDLKVQRVLDAHWG
LLTDEDSVRASSTFHFSYRLKNLDLVSSMAAISASSSPSLLSLRSSSPESSPSLTPSTRR
VSFPSKISHFSRKSSNRDNETGKRTEQIVRSVDERVSDAPPTSKVRKHTISVFVGDESGM
INRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGTERVLQQVIEQLQKLVNVLKVEDIS
SEPQVERELMLVKVNADPESRAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERN
LKKFEIREIVRTGKIALRREKMGATAPFWRFSAASYPDLKEQAPVNVLRGSKTGAIVPPS
ETTAGGDVYPVESTSDLKVQRVLDAHWGLLTDEDTSGLRSHTLSLLVNDVPGVLNLVTGV
FARRGYNIQSLAVGHAEAQGISRITTVVPATDESVSKLVQQLYKLVDVHEVHDLTHLPFS
ERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYG
ICEVARTGRVALARESGVDSKYLRGYSFPLTG
NT seq 2439 nt   +upstreamnt  +downstreamnt
atggcggccatttccgcaagctcttccccatcccttctctccttgagatcgtcatctccc
gaatcttctccctctctcacaccctcgacgcggcgggtatccttcccttcgaagatttct
catttctcccgtaaatcttcgaaccgagacaacgaaacgggaaagagaacggagcaaatc
gttagaagcgtcgacgagagggtctccgatgctccaccaacatcgaaggtgaggaagcac
acgatctcagtgttcgttggagacgaaagcgggatgattaacaggatcgcaggagtcttt
gcgaggagaggttacaacatcgagagtcttgctgttggtctcaacagagacaaggctctc
ttcaccattgttgtctccggcactgaaagggtgcttcagcaggtcatcgagcagcttcag
aagctcgttaatgttctcaaggttgaggatatctccagtgagccgcaagtggagcgtgaa
ctgatgcttgtcaaagtgaatgcagatccggaatccagggctgagatcatgtggctagtt
gacacattcagagcaaaagttgtagacattgcggaacacgcattgactattgaggtaact
ggagatcctgggaaaatgattgctgttgaaagaaatttgaaaaagtttgagatcagagag
attgtcaggacaggaaagatagcactgagaagggaaaagatgggtgctactgctccgttt
tggcgattctcagcagcatcatatccagatctcaaggagcaagcacctgttaatgttctt
cgaggtagcaaaacaggagctatagtccctccaagtgaaacaacagcagggggagatgtt
tatcccgttgagtcaacttctgacctaaaggtgcaacgtgttcttgacgctcactgggga
cttctcacggacgaagatagtgtgcgtgccagtagtacctttcacttctcataccgtctc
aaaaatttggacctcgtctcttcaatggcggccatttccgcaagctcttccccatccctt
ctctccttgagatcgtcatctcccgaatcttctccctctctcacaccctcgacgcggcgg
gtatccttcccttcgaagatttctcatttctcccgtaaatcttcgaaccgagacaacgaa
acgggaaagagaacggagcaaatcgttagaagcgtcgacgagagggtctccgatgctcca
ccaacatcgaaggtgaggaagcacacgatctcagtgttcgttggagacgaaagcgggatg
attaacaggatcgcaggagtctttgcgaggagaggttacaacatcgagagtcttgctgtt
ggtctcaacagagacaaggctctcttcaccattgttgtctccggcactgaaagggtgctt
cagcaggtcatcgagcagcttcagaagctcgttaatgttctcaaggttgaggatatctcc
agtgagccgcaagtggagcgtgaactgatgcttgtcaaagtgaatgcagatccggaatcc
agggctgagatcatgtggctagttgacacattcagagcaaaagttgtagacattgcggaa
cacgcattgactattgaggtaactggagatcctgggaaaatgattgctgttgaaagaaat
ttgaaaaagtttgagatcagagagattgtcaggacaggaaagatagcactgagaagggaa
aagatgggtgctactgctccgttttggcgattctcagcagcatcatatccagatctcaag
gagcaagcacctgttaatgttcttcgaggtagcaaaacaggagctatagtccctccaagt
gaaacaacagcagggggagatgtttatcccgttgagtcaacttctgacctaaaggtgcaa
cgtgttcttgacgctcactggggacttctcacggacgaagatacgagtggactacggtca
catactctatctttgcttgtaaacgatgttccaggagtccttaatcttgtaactggtgtt
ttcgctcgaaggggatacaatattcagagcttggcggtaggacatgctgaagcacagggc
atttcacgcattacaacagttgttcctgcaacagatgaatcagtcagcaaattagtgcag
caactatataaactcgtagatgtacatgaggtccatgatcttactcatttgccattttct
gaaagagaactgatgctgattaagattgctgtgaacgctgctgcaagaagagatgtcctg
gacattgctagtattttcagggcaaaagctgttgacgtatccgatcatacaattactttg
cagcttactggggatcttgacaagatggttgcactgcaaaggttgttggaaccttacggt
atatgcgaggttgcaagaacagggcgtgtggcattggctcgtgaatcaggagtggactct
aagtatcttcgtggatactccttccctttaactggttaa

DBGET integrated database retrieval system