KEGG   Brassica napus (rape): 106354840
Entry
106354840         CDS       T04128                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase, chloroplastic-like
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00660  C5-Branched dibasic acid metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    106354840
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106354840
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     106354840
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 106354840
NCBI-ProteinID: XP_013650340
LinkDB
Position
C6:complement(45339619..45342015)
AA seq 406 aa
MAAALQTNIRPVKFPATFRGLTKQSPAPFRVRCCAVNSAGKKRYNITLLPGDGIGPEVIS
IAKNVLQQAGSLEGVEFSFREMPVGGAALDLVGVPLPEETVSAAKDSDAVLLGAIGGYKW
DKNEKHLKPETGLLQLRAALKVFANLRPATVLPQLVDASTLKREVAEGVDLMVVRELTGG
IYFGVPRGIKTNENGEEVGFNTEVYAAHEIDRIARVAFETARKRRGKLCSVDKANVLEAS
ILWRRRVAALAAEYPDVELSHMYVDNAAMQLVRDPKQFDTIVTNNIFGDILSDEASMITG
SIGMLPSASLSDSGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAKRI
EDAVLGALNKGFRTGDIYSNGTKLVGCKEMGEEVLKSVDSQVHASV
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcggcggctctgcagacgaatatccgaccggtcaagtttccggctacgttcagaggt
ttaaccaaacaatctccggcaccctttagagtaagatgctgcgctgttaattccgctggg
aaaaagcgatacaacatcactctccttcccggagacggcatcggtccagaggtcatctcc
attgctaagaatgtgcttcagcaagctggatccttggaaggagtggagtttagcttcagg
gagatgcctgtaggaggagctgctttggatttggttggagtgcctttgcctgaggagacc
gtctcggctgctaaagactcagatgctgtgcttcttggagccatcggagggtacaaatgg
gataagaatgaaaaacatctaaagcctgagactggtttacttcaacttagggccgctctt
aaagtctttgctaatctcagacctgccacagttcttccacagttagtggatgcttcgacc
ttgaagagagaggttgcagaaggtgttgatctaatggttgtaagggagcttactggaggt
atttactttggagtgccaaggggcattaagactaatgaaaatggtgaggaagttgggttt
aatacggaggtttatgctgctcacgagattgatagaattgctcgtgttgccttcgagact
gctcggaaacggcgtggcaagctgtgttctgttgacaaagccaatgtcttggaggcctcg
attttatggagaagacgagtagcagcattagccgctgaatatcctgatgttgaactgtca
catatgtatgtcgacaatgctgccatgcagcttgttcgtgaccctaaacagtttgacacc
attgtcacaaacaacatttttggtgatatattatccgatgaagcttcaatgatcacagga
agcatcggcatgcttccctctgctagtctcagtgattcgggacctggactctttgaacct
atacatggttctgcacctgatattgctggacaggataaagcaaacccgttggcaaccatc
ctcagcgctgcaatgcttctgaaatacggacttggagaagaaaaagcagctaagagaatt
gaagacgctgtgttgggtgctttgaacaaaggtttcagaacaggagacatctactccaat
ggaactaaactggtgggttgcaaggagatgggagaggaggttctgaagtcagtggactcc
caagttcatgcttctgtataa

KEGG   Brassica napus (rape): 106367226
Entry
106367226         CDS       T04128                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase 3, chloroplastic
  KO
K21360  3-isopropylmalate/methylthioalkylmalate dehydrogenase [EC:1.1.1.85 1.1.1.-]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106367226
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106367226
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     106367226
    1.1.1.-
     106367226
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 106367226
NCBI-ProteinID: XP_013662408
UniProt: A0A816WI17
LinkDB
Position
A2:4641876..4643988
AA seq 406 aa
MAAALQTNTRLNPINVVPGRSLTNPSRAPCRVRCAAASPGKKRFNIALLPGDGIGPEVIS
VAKNVLQQAGSLEGLEFNFQEMPVGGAALDLVGVPLPEESFAAAKQSDAILLGAIGGYKW
DNNEKHLRPEMALFYLRRDLKVFANLRPATVLPQLVDASTLKREVAEGVDMMIVRELTGG
IYFGEPRGIKTDENGEEVGFNTEFYAAHEIDRIARVAFETARKRRGKLCSVDKANVLDAS
ILWRRRVTALASEYPDVELTHMYVDNAAMQLIRDPKQFDTIVTNNIFGDILSDEASMITG
SIGMLPSASLGVSGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAKRI
EDAVLDTLNKGFRTGDIYSPGNKLVGCKEMGEEVLKSVDSKVTATV
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcggcagctttacaaacgaacacacggttgaatccgatcaatgtcgtcccaggcaga
tctctcaccaatccctctcgcgcgccgtgtagagtaaggtgcgccgccgcttcaccgggg
aaaaaacggtttaacatcgctctacttcccggcgacgggatcggtccggaagtcatctcc
gtcgccaagaacgtgcttcaacaagctggatctctcgaaggactggagtttaatttccag
gagatgcctgtcggtggagcagctttggatttggtcggagtgcccttgccggaggaatcc
tttgcagctgctaaacaatctgatgccatacttcttggagctatcggagggtacaaatgg
gacaataatgagaaacatctgagaccagagatggctctgttttaccttagaagagatctc
aaagtctttgcaaacctcagacctgctactgttttgccacagctagttgatgcttccacc
ttgaagagagaagtggcagaaggtgttgatatgatgattgtaagggagcttactggaggt
atctactttggagagccaaggggcattaaaaccgatgaaaatggcgaagaagtcggcttt
aatacagagttctacgctgctcatgagatcgatagaattgctcgtgttgcattcgagact
gctaggaaacggcgtggcaagctgtgttctgtcgacaaagccaatgtgttggatgcatca
atattgtggaggagaagagtaacagcgttagcctctgagtatccagacgttgaactaaca
catatgtatgtcgacaatgctgcaatgcagcttattcgtgaccccaaacagtttgacaca
atagtcaccaataacatttttggtgatatattgtctgatgaggcttcaatgatcactgga
agcattgggatgcttccatctgctagtctcggtgtatcgggacctggactgtttgagcct
atacatggttcagcaccagatatagctggccaggacaaggcaaacccattggccaccatt
ctcagcgctgcaatgcttctgaaatatggacttggagaagaaaaggctgcaaagaggatc
gaagacgcggtgttggatactttgaacaaagggtttagaaccggtgacatctactcccct
ggaaataaactggtgggatgcaaggagatgggtgaggaagtgctaaaatcagtggactcc
aaagttacagctactgtttaa

KEGG   Brassica napus (rape): 106379685
Entry
106379685         CDS       T04128                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase 3, chloroplastic isoform X1
  KO
K21360  3-isopropylmalate/methylthioalkylmalate dehydrogenase [EC:1.1.1.85 1.1.1.-]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106379685
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106379685
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     106379685
    1.1.1.-
     106379685
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 106379685
NCBI-ProteinID: XP_013675035
UniProt: A0A078JQ35
LinkDB
AA seq 406 aa
MAAALQTNTRLNPINLVPGRSLANPSRAPCRVRCAAASPGKKRFNIALLPGDGIGPEVIS
VAKNVLQQAGSLEGLEFNFQEMPVGGAALDLVGVPLPEESFTAAKQSDAILLGAIGGYKW
DNNEKHLRPEMALFYLRRDLKVFANLRPATVLPQLVDASTLKREVAEGVDMMIVRELTGG
IYFGEPRGIKTNENGEEVGFNTEFYAAHEIDRIARVAFETARKRRGKLCSVDKANVLDAS
ILWRRRVTALASEYPDVELTHMYVDNAAMQLIRDPKQFDTIVTNNIFGDILSDEASMITG
SIGMLPSASLGVSGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAKRI
EDAVLDTLNKGFRTGDIYSPGNKLVGCKEMGEEVLKSVDSKVTATV
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcggcagctttacaaacgaacacacggttgaatccgatcaatctcgttccaggcaga
tctctcgccaatccttctcgcgcgccgtgtagagtaaggtgcgccgcagcttcaccgggg
aaaaaacggtttaacatcgctctccttcccggcgacgggattggtccggaagtcatatcc
gtcgccaagaacgtgctccaacaagctggatcactcgaaggactggagtttaatttccag
gagatgcctgtcggaggagcagctttggatttggtcggagtgcccttgcctgaggaatcc
tttacagctgctaaacaatctgatgccatacttcttggagctatcggagggtacaaatgg
gacaacaatgagaaacatctgagacctgagatggctctgttttaccttcgaagagatctc
aaagtctttgcaaacctcagacccgctacagttttgccacagctagttgatgcttccacc
ttgaagagagaagtggcagaaggggttgatatgatgattgtaagggagcttactggaggt
atttactttggagagccaaggggaatcaagaccaacgaaaatggcgaagaagtaggcttt
aatacagagttctacgctgctcatgagatcgataggattgctcgtgttgctttcgagact
gctaggaaacggcgtggcaagctgtgttctgtcgacaaagccaatgtgttggacgcatca
atattatggaggagaagagtaacagcgttagcctctgagtatccagacgttgaactaaca
catatgtatgtcgataatgctgcaatgcagcttattcgtgaccccaaacagtttgacaca
attgtcaccaataacatttttggtgatatattatctgatgaagcttcaatgatcactgga
agcattgggatgcttccatctgctagtctcggtgtatcgggacctggactgtttgagcct
atacatggttcagcaccagatatagctggtcaggacaaggcaaacccattggccaccatt
ctcagcgctgcaatgctcctgaaatatggacttggagaagaaaaggctgcaaagaggatc
gaagacgcggtcttggatactttgaacaaagggtttagaaccggtgacatctactcccct
ggaaataaactggtgggatgcaaggagatgggtgaggaagtgctaaaatcagtggactcc
aaagttacagctactgtttaa

KEGG   Brassica napus (rape): 106398379
Entry
106398379         CDS       T04128                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase, chloroplastic
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00660  C5-Branched dibasic acid metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    106398379
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106398379
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     106398379
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 106398379
NCBI-ProteinID: NP_001303020
UniProt: P29102
LinkDB
Position
C3:complement(21833392..21835737)
AA seq 406 aa
MAAALQTNIRPVKFPATLRALTKQSSPAPFRVRCAAASPGKKRYNITLLPGDGIGPEVIS
IAKNVLQQAGSLEGLEFSFQEMPVGGAALDLVGVPLPEETVSAAKESDAVLLGAIGGYKW
DKNEKHLKPETGLLQLRAGLKVFANLRPATVLPQLVDASTLKREVAEGVDLMVVRELTGG
IYFGVPRGIKTNENGEEVGYNTEVYAAHEIDRIARVAFETARKRRGKLCSVDKANVLDAS
ILWRRRVTALAAEYPDVELSHMYVDNAAMQLVRDPKQFDTIVTNNIFGDILSDEASMITG
SIGMLPSASLSDSGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAKRI
EDAVLGALNKGFRTGDIYSAGTKLVGCKEMGEEVLKSVDSHVQASV
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcggcggctctgcagactaacatccgaccggttaagtttccggctacgttgagagct
ctcaccaaacaatcttctccagcaccctttagagtgagatgcgccgctgcttcccccggg
aaaaagagatacaatatcactctccttcccggcgatggaatcggtccggaggtcatctcc
atcgctaaaaatgtgcttcagcaagctggttccttggaaggtctggagtttagcttccag
gaaatgcctgtaggaggagctgctttggatttggtcggagtgcctttgcctgaggagacc
gtctcggctgctaaagaatcagatgctgtgcttcttggagccattggagggtacaaatgg
gataagaatgaaaaacatttgaagcctgagactgggttacttcaacttcgggctggtctt
aaagtctttgctaatctgagacctgctacagttcttccacagttagtggatgcttcgacc
ttgaagagagaggttgcagaaggtgttgatctgatggttgttagggagcttacaggaggt
atttactttggagtgccaaggggcattaagactaatgaaaatggtgaggaagttgggtat
aataccgaggtctatgctgctcacgagattgatagaattgctcgtgttgccttcgagact
gctcggaaacggcgtggcaagctgtgttctgttgacaaagctaatgtcttagatgcctcg
attttatggaggagacgagtaacagcactagctgctgaatatccggatgttgaactgtca
catatgtatgttgacaatgctgccatgcagcttgttcgtgaccctaaacagtttgacacc
attgttacaaacaacatttttggtgatatattatccgatgaagcgtcgatgatcacagga
agcatcggcatgcttccctctgctagtctcagtgattcgggacctggactctttgaacct
atacatggttctgcacctgatattgctggacaggataaagcaaacccgttggcaaccatc
ctcagcgctgcaatgcttctgaaatacggactcggagaggagaaggcagctaagagaatc
gaagacgctgtgttgggtgctctgaacaaaggattcagaacaggagacatctactccgca
ggaactaaacttgtgggctgcaaggagatgggagaggaagttctgaagtcagtggattcc
cacgttcaagcttctgtttaa

KEGG   Brassica napus (rape): 106398388
Entry
106398388         CDS       T04128                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase 2, chloroplastic-like
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00660  C5-Branched dibasic acid metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    106398388
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106398388
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     106398388
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 106398388
NCBI-ProteinID: XP_013694410
LinkDB
Position
A2:complement(21568530..21571650)
AA seq 415 aa
MSTALQIHASGIKLPVSLIPSTTKQISRASKRVGRIRCSATTPNKKYTIAVLPGDGIGTE
VTPVAVEALRLAGSLEGIDFEFKEMLVGGAAYEATGVPFPEETLKASLESDAVYLGAVGI
TKKMPSSDHLPKHLRPEVGLMRIRRALGVYANLRPITVFPQLLEASSLKRSVTEEVDFMI
IRELAGGLYYGKPRGFGINEKGEDTGFCTEIYSSSEVDRVARIAFDMAMERRGKVCSVDK
ATILESSRLWRKRVTIMSEEYPEVDLSHMLVDTSGMELIRYPKQFDVLLTTNVFGDILSD
VSAMITGGIGMLPSACIGGPGPQLFEPVHGSAPDIEGEDVANPLAAVLTAVMLLRYGLKE
EAVAKRIENAIFDTLNEGFRTRDISTPGAKIVGCKKMGEEILKSLYVRVPPYQLN
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgtcgacagcacttcagatccacgcaagcggaatcaaattaccggtctcacttattcct
agtactaccaaacaaatctctagggctagtaaacgtgttggtaggatcagatgctccgcc
accacaccaaataaaaagtacaccattgccgtcctccccggtgatggcatcggcactgaa
gtcactccagttgccgtcgaagctctccgcctcgctggctctctcgaaggaattgatttc
gagtttaaggagatgttggtcggtggtgccgcttacgaggccaccggagttccgttcccg
gaagaaaccctaaaagcgtctcttgagtccgacgctgtttacctaggagcagttggtatc
accaaaaagatgccgtcgtcggatcatctaccgaagcatctaaggcctgaagttggcctg
atgcgtatccgaagagctctcggagtatatgctaatctcagacccatcaccgtctttcct
cagttattggaagcttcctctttgaagaggagtgtgacggaagaggttgactttatgatc
ataagagagctcgctggaggtttgtattatggaaaaccaagaggctttggaatcaacgaa
aagggcgaggataccggtttctgcacggagatttattccagtagcgaggttgatcgtgtc
gctcgaattgcatttgacatggcaatggaacgacgtggcaaagtctgctcagtcgacaaa
gctaccatcttggaatcgtcgaggttgtggaggaaacgagtgacgattatgtcggaagag
tatccagaagttgatctgtcgcatatgctagtggacacatctggcatggagctgattcgg
taccccaaacaattcgacgtactcttgacaacgaatgtctttggagatatcttgtcggat
gtttcagctatgatcaccggcggcattggaatgcttccctccgcctgcatcggaggcccg
ggaccgcaactcttcgaacctgttcacggttcagctcctgacatcgagggagaggacgta
gcaaatccactggctgcggttctcacggccgtgatgcttctgaggtatggtttgaaggaa
gaagcggtcgcaaaacgcatagaaaatgctatttttgataccttaaacgaaggtttcaga
acgcgtgatatttccactcccggagccaaaattgtgggatgcaagaagatgggtgaagaa
atattgaagtcactttacgtcagagttccgccgtatcaattgaactag

KEGG   Brassica napus (rape): 106398399
Entry
106398399         CDS       T04128                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase, chloroplastic-like
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00660  C5-Branched dibasic acid metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    106398399
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106398399
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     106398399
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 106398399
NCBI-ProteinID: XP_013694417
LinkDB
Position
A2:complement(21555723..21557797)
AA seq 348 aa
LHALRLAGSLEGLDLRFEELPIGGAALELVGVPLPEETLRKAKQSDAVLLGAVGWPKWDN
SPKHLKPITALLQLRAGLEVFSNLRPITVFPQLVDSTYLRKDTAEGVDIMIIRELTGGIY
NAHPRGFTTNEQGDEVGFCTESYSASEVDHIARVAFDIAKQRRSKLCSVDKATILEGSML
WRKRVTAMGLEYPEVEVSHLLIDTAAMDLVRYPRQFDTILTGVMFGDILSDLAAMIPGSV
GLLPSAALGDSGPGIFEPVHGSAPKHYGKDTVNPLAAVLSAAMLFRYGLKEENAAQRIEK
AVSDVLDRGFRTRDILTPGTTLVGCKRMGEEILRSLDARVSVSNGSLV
NT seq 1047 nt   +upstreamnt  +downstreamnt
ttacacgctcttcgtctagctggatcgctcgaagggctagatttgaggttcgaggagctg
cccataggaggtgctgctttggaactcgtcggagttccactaccggaggaaacattgaga
aaggcaaagcagtcggatgctgttcttctcggggctgttggatggccgaaatgggataac
agtccgaagcacttgaagcctataacggcgctgttgcagcttcgtgcgggtcttgaagtg
ttttccaatttaaggcccatcactgtgttccctcagctggttgattcgacgtatctgaga
aaagacacggccgaaggggttgacattatgatcatccgggagcttactggaggtatttac
aatgcgcaccctcgggggtttaccactaatgaacaaggtgacgaagttggcttttgcact
gagtcctactctgcaagtgaggttgatcacattgctcgtgttgcatttgatattgccaag
caacggcgcagtaaactttgctctgttgacaaggctactatccttgagggatcaatgttg
tggaggaaaagagtcacagcaatgggcttagagtatcccgaggttgaagtgagtcatttg
cttattgacaccgctgcgatggatcttgttcggtacccaagacagttcgataccattttg
actggagtcatgtttggtgatatcctctctgatcttgcggccatgatccctggaagtgta
ggattgcttccatctgctgcccttggtgattcaggacctggaatctttgaacccgtgcat
ggatctgcacctaaacactacggaaaggacacagtgaaccccttggcagctgttctatca
gctgcaatgcttttcaggtacggactgaaagaggaaaacgctgcacagaggatcgagaag
gcagtttcagatgtcttggaccgcggattcagaactcgtgacattctcactcctggaact
acattggtaggttgcaagagaatgggagaggaaatactgagatcccttgatgctagagtc
tctgtttcaaacggaagtttggtttag

KEGG   Brassica napus (rape): 106429911
Entry
106429911         CDS       T04128                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase 3, chloroplastic isoform X1
  KO
K21360  3-isopropylmalate/methylthioalkylmalate dehydrogenase [EC:1.1.1.85 1.1.1.-]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106429911
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106429911
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     106429911
    1.1.1.-
     106429911
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 106429911
NCBI-ProteinID: XP_013726132
UniProt: A0A078JQ35
LinkDB
Position
C2:3052594..3054698
AA seq 406 aa
MAAALQTNTRLNPINLVPGRSLANPSRAPCRVRCAAASPGKKRFNIALLPGDGIGPEVIS
VAKNVLQQAGSLEGLEFNFQEMPVGGAALDLVGVPLPEESFTAAKQSDAILLGAIGGYKW
DNNEKHLRPEMALFYLRRDLKVFANLRPATVLPQLVDASTLKREVAEGVDMMIVRELTGG
IYFGEPRGIKTNENGEEVGFNTEFYAAHEIDRIARVAFETARKRRGKLCSVDKANVLDAS
ILWRRRVTALASEYPDVELTHMYVDNAAMQLIRDPKQFDTIVTNNIFGDILSDEASMITG
SIGMLPSASLGVSGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAKRI
EDAVLDTLNKGFRTGDIYSPGNKLVGCKEMGEEVLKSVDSKVTATV
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcggcagctttacaaacgaacacacggttgaatccgatcaatctcgttccaggcaga
tctctcgccaatccttctcgcgcgccgtgtagagtaaggtgcgccgcagcttcaccgggg
aaaaaacggtttaacatcgctctccttcccggcgacgggattggtccggaagtcatatcc
gtcgccaagaacgtgctccaacaagctggatcactcgaaggactggagtttaatttccag
gagatgcctgtcggaggagcagctttggatttggtcggagtgcccttgcctgaggaatcc
tttacagctgctaaacaatctgatgccatacttcttggagctatcggagggtacaaatgg
gacaacaatgagaaacatctgagacctgagatggctctgttttaccttcgaagagatctc
aaagtctttgcaaacctcagacccgctacagttttgccacagctagttgatgcttccacc
ttgaagagagaagtggcagaaggtgttgatatgatgattgtaagggagcttactggaggt
atttactttggagagccaaggggaatcaagaccaacgaaaatggcgaagaagtaggcttt
aatacagagttctacgctgctcatgagatcgataggattgctcgtgttgctttcgagact
gctaggaaacggcgtggcaagctgtgttctgtcgacaaagccaatgtgttggacgcatca
atattatggaggagaagagtaacagcgttagcctctgagtatccagacgttgaactaaca
catatgtatgtcgataatgctgcaatgcagcttattcgtgaccccaaacagtttgacaca
attgtcaccaataacatttttggtgatatattatctgatgaagcttcaatgatcactgga
agcattgggatgcttccatctgctagtctcggtgtatcgggacctggactgtttgagcct
atacatggttcagcaccagatatagctggtcaggacaaggcaaacccattggccaccatt
ctcagcgctgcaatgcttctgaaatatggacttggagaagaaaaggctgcaaagaggatc
gaagacgcggtcttggatactttgaacaaagggtttagaaccggtgacatctactcccct
ggaaataaactggtgggatgcaaggagatgggtgaggaagtgctaaaatcagtggactcc
aaagttacagctactgtttaa

KEGG   Brassica napus (rape): 106430755
Entry
106430755         CDS       T04128                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase, chloroplastic-like
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00660  C5-Branched dibasic acid metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    106430755
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106430755
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     106430755
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 106430755
NCBI-ProteinID: XP_013727005
UniProt: A0A078HRR3
LinkDB
Position
C6:complement(45025261..45027634)
AA seq 406 aa
MAAALQANIRPVKFPATLRALTKQSPAPFRVRCCAVNSAGKKRYNITLLPGDGIGPEVIS
IAKNVLQQAGSLEGVEFSFREMPVGGAALDLVGVPLPEDTISAAKDSDAVLLGAIGGYKW
DKNEKHLKPETGLLQLRAALKVFANLRPATVLPQLVDASTLKKEVAEGVDLMVVRELTGG
IYFGEPRGIKTNENGEEVGFNTEVYAAHEIDRIARVAFETARKRRGKLCSVDKANVLDAS
ILWRRRVTALAAEYPDVELSHMYVDNAAMQLVRDPKQFDTIVTNNIFGDILSDEASMITG
SIGMLPSASLSDSGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAKRI
EDVVLGALNKGFRTGDIYSNGTKLVGCKEMGEEVLKSVDSQVHASV
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcggcggctctgcaggcgaatatccgaccggtcaagtttccggctacgttaagagct
ctaaccaaacaatcgccggcaccctttagagtaagatgctgcgctgttaattccgctggg
aaaaagcgatacaacatcactctccttcccggagacggcatcggtccggaggttatctcc
atcgctaaaaatgtgcttcagcaagctggatccttggaaggagtggagtttagctttagg
gagatgcctgtaggaggagctgctttggatttggttggagtgcctttgcctgaggacacc
atctccgctgctaaagattcagatgctgtgcttcttggagccatcggagggtacaaatgg
gataagaatgaaaaacatctgaagcctgagactggtttacttcaacttcgggccgctctt
aaagtctttgctaatctcagacctgctactgttcttccacagttagttgatgcctcgacc
ttgaaaaaagaggttgctgaaggtgttgatctaatggttgtaagggagcttactggaggt
atatactttggagagccaaggggcattaagactaatgaaaatggtgaggaagttgggttt
aataccgaggtctatgctgctcacgagattgatagaattgctcgtgttgccttcgagact
gctcgtaagcgacgtggcaagttgtgttctgtcgacaaagctaatgtcttggatgcctcg
attttatggaggaggcgagtaacagcattagccgctgaatatcctgatgttgaactgtca
catatgtacgtcgacaatgctgccatgcagcttgttcgtgaccctaaacagtttgacacc
attgtcacaaacaacatttttggtgatatattatccgatgaagcttcaatgatcacaggg
agcatcggcatgcttccttctgctagtctcagtgactcgggacctggactctttgaacca
atacatggttctgcacctgatattgctggacaggataaagcaaacccgttagcaaccatc
ctcagcgctgcaatgcttctgaaatacggacttggagaagaaaaggcagctaagaggatc
gaagacgtggtgttgggtgctctgaacaaagggtttagaacaggagacatctactccaat
ggaaccaaactggtggggtgcaaggagatgggagaggaggttctgaagtcagtggactcc
caagttcatgcttctgtttag

KEGG   Brassica napus (rape): 111197702
Entry
111197702         CDS       T04128                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase, chloroplastic
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00660  C5-Branched dibasic acid metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    111197702
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    111197702
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     111197702
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 111197702
NCBI-ProteinID: XP_022559308
LinkDB
Position
A2:complement(21552322..21554703)
AA seq 406 aa
MAAALQTNIRPVKFPATFRALTKQSSPAPFRVRCAAASPGKKRYNITLLPGDGIGPEVIS
IAKNVLQQAGSLEGLEFSFQEMPVGGAALDLVGVPLPEETVSAAKESDAVLLGAIGGYKW
DKNEKHLKPETGLLQLRAGLKVFANLRPATVLPQLVDASTLKREVAEGVDLMVVRELTGG
IYFGVPRGIKTNENGEEVGYNTEVYAAHEIDRIARVAFETARKRRGKLCSVDKANVLDAS
ILWRRRVTALAAEYPDVELSHMYVDNAAMQLVRDPKQFDTIVTNNIFGDILSDEASMITG
SIGMLPSASLSDSGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAKRI
EDAVLGALNKGFRTGDIYSAGTKLVGCKEMGEEVLKSVDSHVQASV
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcggcggctctgcagactaacatccgaccggttaagtttccggctacgttccgagct
ctcaccaaacaatcttctcccgcaccctttagagtgagatgcgccgctgcttcccccggg
aaaaagagatacaacatcactctccttcccggcgacggaatcggtccggaggtcatctcc
atcgctaaaaatgtgcttcagcaagctggttccttggaaggtctggagtttagcttccag
gaaatgcctgtaggaggggctgctttggatttggtcggagtgcctttgcctgaggagacc
gtctctgctgctaaagaatcagatgctgtgcttcttggagccattggagggtacaaatgg
gataagaatgaaaagcatctgaagcctgagactgggttgcttcaacttcgggctggtctt
aaagtctttgctaatctgagacctgctacggttcttccacagttagtggatgcttcgacc
ttgaagagagaggttgcagaaggtgttgatctgatggttgttagggagcttacaggaggt
atttactttggagtgccaaggggcattaagactaatgaaaatggtgaggaagttgggtat
aataccgaggtctatgctgctcacgagattgatagaattgctcgtgttgccttcgagact
gctaggaaacggcgtggcaagctgtgttctgttgacaaagctaatgtcttggatgcatcg
attttatggaggagacgagtaacagcactagcagctgaatatcctgatgttgaactgtca
catatgtatgttgacaatgctgccatgcagcttgttcgtgaccccaaacagtttgacacc
attgttacaaacaacatttttggtgatatattatccgatgaagcgtcgatgatcacagga
agcatcggcatgcttccctctgctagtctcagtgattcgggacctggactctttgaacct
atacatggttctgcacctgatattgctggacaggataaagcaaacccgttggcaaccatc
ctcagcgctgcaatgcttctgaaatacggacttggagaggagaaggcagctaagagaatt
gaagacgctgtgttgggtgctctgaacaaaggattcagaacaggagacatctactccgca
ggaactaaacttgtgggctgcaaggagatgggagaggaagttctgaagtcagtggattcc
cacgttcaagcttctgtttaa

KEGG   Brassica napus (rape): 111203603
Entry
111203603         CDS       T04128                                 
Name
(RefSeq) uncharacterized protein LOC111203603
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00660  C5-Branched dibasic acid metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    111203603
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    111203603
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     111203603
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 111203603
NCBI-ProteinID: XP_022553224
LinkDB
Position
C3:complement(21837713..21840156)
AA seq 225 aa
MALATRHEHTLPRGYKDTSSSRVSSGSTHDRYTSIKFSTKRSARAHAVTRLKLKLLPGPS
SFGYFARALVVTRLQLTRLHDHKVESSCGYSDVEKKIHLASPRNSLSVTSSSRGMTYARS
NSVSRKRQGPGIFEPVHGSAPKHYGKDTVNPLAAVLSAAMLFRYGLKEENAAQRIEKAVS
DVLDRGFRTRDIHTPGATLVGCKRMGEEILRSLDARVSVSNGSLV
NT seq 678 nt   +upstreamnt  +downstreamnt
atggctctcgcaacacgtcacgagcacacgcttccaaggggctacaaagacacctcgtca
tctagagtctcctcggggtcaactcatgatcgatacacctcgatcaagttctccaccaag
cgatcggctcgagctcatgcggttactcggcttaagcttaagctgctacccggccctagc
tcattcggttactttgctcgagctcttgtggttactcggctccagctcacgcgtttacac
gaccacaaagttgagagctcatgcggttactcggacgtggagaagaagattcatctcgcg
tcccctcgcaactctttgtcagtcacaagctcgagcagagggatgacgtacgcacgttca
aattctgtttcaagaaaacgacaaggacctggaatcttcgaacccgtgcatggatctgcg
cctaaacactacggaaaggacacagtgaaccccttggcagctgtgctatcagctgcaatg
cttttcaggtacggactgaaagaggaaaacgctgcacagaggatcgagaaggcagtttca
gatgtcttggaccgcggattcagaactcgtgacattcacactcctggagctacattggta
ggttgcaagagaatgggagaggagatactgagatcccttgatgcaagagtctctgtttca
aacggaagtttggtttag

DBGET integrated database retrieval system