KEGG   Brassica napus (rape): 106381416
Entry
106381416         CDS       T04128                                 
Name
(RefSeq) 3-isopropylmalate dehydratase large subunit, chloroplastic isoform X1
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00660  C5-Branched dibasic acid metabolism
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    106381416
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106381416
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106381416
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     106381416
    4.2.1.35  (R)-2-methylmalate dehydratase
     106381416
SSDB
Motif
Pfam: Aconitase
Other DBs
NCBI-GeneID: 106381416
NCBI-ProteinID: XP_013676766
LinkDB
Position
C5:complement(10357220..10361304)
AA seq 505 aa
MASSVISSSPFLCKSAQQKDLGFPKSSQISVHRCQKRAISRKIVSVMAPQRSSSATGSVK
TGMTMTEKILAKAAEKSQVVPGDNIWVNVDVLMTHDVCGPGAFGIFKREFGEKAKVWDPE
KIVVIPDHYIFTTDKRANRNVDIMREHCREQNIKYFYDITDLGDFRANPDYKGVCHVALA
QEGHCRPGEVLLGTDSHTCTAGAFGQFATGIGNTDAGFVLGTGKILLKVPPTMRFILDGE
MPSYLQAKDLILQIIGEISVAGATYKTMEFSGTTIESLTMEERMTLCNMVVEAGGKNGVI
PPDATTFNYVENRTSVPFEPVYSDGNASFIADYRFDVSKLEPVVAKPHSPDNRALARECK
DVKIDRVYIGSCTGGKTEDFMAAAKLFHAAGKQVKVPTFLVPATQKVWMDVYALPVPGAG
GKTCAQIFEEAGCDTPTSPSCGACLGGPADTYARLNEPQVCVSTTNRNFPGRMGHKEGQI
YLVSPYTAAASALTGHVTDPREFLQ
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggcttcctctgtaatctcttcatctcctttcctctgcaaatccgcccagcagaaggat
ttggggttccctaaatcgtcgcagatttcggttcacagatgtcagaagagagcgatttct
cggaagatcgtctccgtcatggcgccgcagcgatcatccagcgccactggatcggtgaaa
actgggatgacgatgacggagaagattcttgccaaggcagcagagaaatcacaagtggtg
cctggtgataacatctgggttaacgttgacgttctcatgactcatgatgtctgtggccct
ggtgcttttggtatcttcaagagagagttcggtgaaaaagctaaggtttgggacccagag
aagattgttgttattccagaccattacatcttcactactgataagcgtgccaaccgcaat
gtcgacattatgagggaacattgcagggaacagaacatcaagtatttctatgatatcacc
gaccttggagattttcgggctaatcctgactacaaaggtgtttgccatgtggcgcttgca
caagaaggtcattgcaggccaggagaggttttgttaggaacagactcgcacacatgtact
gctggagcgtttggtcagtttgctacagggattggaaacaccgatgctggatttgtgtta
ggcactggcaaaatcctccttaaggttccaccaacaatgaggtttatcttggatggtgaa
atgcccagttatctgcaagcaaaggatctgattttacaaatcattggagaaatatctgtt
gctggtgcaacttacaagacgatggagttcagtggaacaactattgaaagtctgactatg
gaagaaagaatgacattgtgcaacatggttgtggaagctgggggaaagaatggtgtcatc
cctcctgatgcgacgacatttaattacgttgagaacaggacatctgtaccctttgagccc
gtatatagtgatggaaatgcaagctttattgcagattatcgatttgacgtgtcaaagctg
gagcctgtggtggctaagcctcattctcctgacaaccgggctctagcaagagaatgcaaa
gatgtcaaaattgacagagtatacattggttcttgtactggtgggaagactgaggatttt
atggctgcagctaaacttttccatgcagcaggaaagcaagtcaaagtcccaactttcctt
gtccccgctactcagaaggtgtggatggatgtgtatgccctccctgtgcctggagcaggt
ggaaagacgtgtgcgcagatattcgaagaagctggctgcgacacaccaaccagtcctagt
tgtggtgcctgccttggtggcccagctgacacctatgctcgcttgaatgaacctcaagtg
tgtgtctcgacaacgaacagaaactttcctggtcggatgggacacaaagaagggcagatt
tacttggtttctccttacaccgctgcagcctcggctctgaccggccatgtcaccgaccca
agagagttcttgcagtag

KEGG   Brassica napus (rape): 106388413
Entry
106388413         CDS       T04128                                 
Name
(RefSeq) 3-isopropylmalate dehydratase large subunit, chloroplastic-like
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00660  C5-Branched dibasic acid metabolism
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    106388413
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106388413
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106388413
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     106388413
    4.2.1.35  (R)-2-methylmalate dehydratase
     106388413
SSDB
Motif
Pfam: Aconitase
Other DBs
NCBI-GeneID: 106388413
NCBI-ProteinID: XP_013683934
LinkDB
Position
A3:17688007..17691585
AA seq 508 aa
MASSVISSSPFVCKSPAKKDLGFSSFRKPSQISIHGCQRKSISRKIVSVMAPQRSSSTSG
SVKTGMTMTEKILAKAAEKSQVVPGDNIWVNVDVLMTHDVCGPGAFGIFKREFGDNAKVW
DSEKIVVIPDHYIFTTDKRANRNVDIMREHCREQNIKYFYDITDLGDFRANPDYKGVCHV
ALAQEGHCRPGEVLLGTDSHTCTAGAFGQFATGIGNTDAGFVLGTGKILLKVPPTMRFIL
DGEMPSYLQAKDLILQIIGEISVAGATYKTMEFSGTTIESLTMEERMTLCNMVVEAGGKN
GVIPPDATTFNYVENRTSVPFQPVYSDANASFVADYRFDVSKLEPVVAKPHSPDNRALAR
ECKDVKIDRVYIGSCTGGKTEDFMAAAKLFHAAGMQVKVPTFLVPATEQVWMDVYALPVP
GAGGKTCAQIFEEAGCDTPTSPSCGACLGGPADTYARLNEPQVCVSTTNRNFPGRMGHKE
GQIYLASPYTAAASALTGHVTDPREFLQ
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggcttcctctgtaatctcttcctctcccttcgtctgcaaatcccccgctaagaaggat
ttggggttttcgtcgttccgtaaaccatcgcagatttcgattcatggatgccagaggaaa
tcgatttctcggaagatcgtctccgtcatggctccgcagcgctcatcgtccacctcagga
tcggtgaaaactgggatgacgatgacggagaagattctggcgaaggcagcagagaagtca
caagtggtccctggtgataacatttgggttaacgttgatgttcttatgactcatgatgtc
tgtggccctggcgcttttggtatcttcaaaagagagttcggtgataacgctaaggtttgg
gactcggagaagatcgttgttataccagaccattacatattcactactgataagcgtgct
aaccgcaacgtcgacattatgagggagcattgcagggaacagaacatcaagtatttctat
gatatcaccgacctcggagattttagggctaatcctgactacaaaggtgtttgccatgtt
gcgcttgcacaagaaggtcattgcaggccaggagaggttttgttaggaacagactcacac
acatgtactgctggagcatttggtcagtttgctacagggattggaaacactgatgcaggc
tttgtgttaggcactggaaaaatcctccttaaggttccaccaactatgaggtttatcttg
gatggtgaaatgcccagttatttgcaagcaaaggatctgattctgcagatcattggtgaa
atatctgttgctggcgcaacttacaagacgatggagttcagtggtacaactattgaaagt
ctgactatggaagaacgaatgacattgtgcaacatggtggtggaagctgggggaaagaat
ggtgtcatccctcctgatgcgacgacatttaattacgttgagaataggacatctgtaccc
tttcagcctgtatatagtgatgcaaatgcaagttttgtggcagattatagatttgatgtg
tcgaagctagagcctgtagtggctaagcctcattctcctgataatcgtgctctagcgaga
gaatgcaaagatgtgaaaattgacagagtatacatcggttcttgtactggtgggaagact
gaggattttatggctgcagctaaacttttccatgcagcaggaatgcaagtcaaagttcca
actttccttgtcccggccactgaacaggtgtggatggacgtgtatgcactcccagtacct
ggagcaggtggaaagacgtgtgcgcagatattcgaagaagctggatgtgacacaccaacc
agtcctagctgtggtgcctgccttggtggcccagcagacacctacgctcgtttgaatgaa
cctcaagtgtgtgtctcgacaacgaacaggaacttccccggtcggatgggacacaaagaa
gggcagatatacttggcttctccttacactgctgcagcctcggctctaaccggccatgtc
accgacccaagagagttcttgcagtag

KEGG   Brassica napus (rape): 106421017
Entry
106421017         CDS       T04128                                 
Name
(RefSeq) 3-isopropylmalate dehydratase small subunit 3-like
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00660  C5-Branched dibasic acid metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    106421017
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106421017
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     106421017
    4.2.1.35  (R)-2-methylmalate dehydratase
     106421017
SSDB
Motif
Pfam: Aconitase_C
Other DBs
NCBI-GeneID: 106421017
NCBI-ProteinID: XP_013717319
LinkDB
Position
A5:2078297..2081423
AA seq 248 aa
MAAASLRSVNPTLPRTLPSPTRSPPFQSPFLRFAPTSTSFNLKPLVTPPSPFVTRSAAAS
PQERKTFHGLCYVVGDNIDTDQIIPAEFLTLVPSNPEEYQKLGSHALVGLPASYKDRFVE
PGETKTKYSIIIGGENFGCGSSREHAPVCLGAAGAKAVVAQSYARIFFRNSVATGEIYPL
DSEVRVCDECSTGDVATVELREGDSVLINHTTGKEYKLKAIGDAGPVIDAGGIFAYARKA
GMIPSAAA
NT seq 747 nt   +upstreamnt  +downstreamnt
atggcggcggcgtctctccgatctgtaaaccctacattaccccgaaccctaccttctccc
acaaggtctcctcccttccaatcaccattcctcagattcgctccaacctccacctccttc
aacctcaaacccctcgtcactcccccctcacccttcgtgacccgctccgccgcagcctcg
ccgcaagagagaaagaccttccacggcctctgctacgtcgtcggcgacaacatcgacacc
gaccagatcatcccggctgagtttctcaccctcgtcccctccaacccggaggaataccaa
aagctcggctcccacgccttggtcggcctcccagcttcgtacaaggaccggttcgtggag
ccgggggagacgaagacgaagtactcgatcatcatcggcggggagaacttcgggtgcggg
tcgtcgagggagcacgcgccggtgtgcttgggagcggcgggggcgaaggcggtggtggcg
cagtcgtacgcgaggatctttttcaggaactcggtggcgaccggggagatttatccgctg
gactcggaggttagggtgtgtgatgagtgtagtacgggggatgtcgcgacggtggagctg
agggaaggggatagtgttttgattaatcatacgacggggaaggagtataagcttaaggct
attggtgacgctgggcctgtgattgatgctggtggtatctttgcgtatgcgaggaaggct
gggatgattccttctgcagctgcttga

KEGG   Brassica napus (rape): 106426997
Entry
106426997         CDS       T04128                                 
Name
(RefSeq) 3-isopropylmalate dehydratase large subunit, chloroplastic-like
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00660  C5-Branched dibasic acid metabolism
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    106426997
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106426997
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106426997
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     106426997
    4.2.1.35  (R)-2-methylmalate dehydratase
     106426997
SSDB
Motif
Pfam: Aconitase
Other DBs
NCBI-GeneID: 106426997
NCBI-ProteinID: XP_013723181
LinkDB
Position
C4:45089571..45093229
AA seq 507 aa
MASSVISSSPFVCKSPAKDLGFSSFRKPSQISIHGCQKKSISRKIVSVMAPQRSSSTSGS
VKTGMTMTEKILAKAAEKSQVVPGDNIWVNVDVLMTHDVCGPGAFGIFKREFGENAKVWD
SEKIVVIPDHYIFTTDKRANRNVDIMREHCREQNIKYFYDITDLGDFRANPDYKGVCHVA
LAQEGHCRPGEVLLGTDSHTCTAGAFGQFATGIGNTDAGFVLGTGKILLKVPPTMRFILD
GEMPSYLQAKDLILQIIGEISVAGATYKTMEFSGTTIESLTMEERMTLCNMVVEAGGKNG
VIPPDATTFNYVENRTSVPFQPVYSDGNASFVADYRFDVSKLEPVVAKPHSPDNRALARE
CKDVKIDRVYIGSCTGGKTEDFMAAAKLFHAAGKQVKVPTFLVPATQKVWMDVYALPVPG
AGGKTCAQIFEEAGCDTPTSPSCGACLGGPADTYARLNEPQVCVSTTNRNFPGRMGHKEG
QIYLASPYTAAASALTGHVTDPREFLQ
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggcttcctctgtaatctcttcctctcctttcgtctgcaaatcccccgctaaggatttg
gggttttcttcgttccgtaaaccatcgcagatttcgattcatggatgccagaagaaatcg
atttctcggaagatcgtctccgtcatggctccgcagcgctcatcgtccacctcaggatcg
gtgaaaactgggatgacgatgacggagaagattctggcgaaggcagcagagaagtcacaa
gtggtccctggtgataacatttgggttaacgttgatgttcttatgactcacgatgtctgt
ggccctggcgcttttggtatcttcaaaagagagttcggtgaaaacgctaaggtttgggac
tccgagaagatcgttgttataccagaccattacatattcacaactgataagcgtgctaac
cgcaacgtggacattatgagggagcattgcagggaacagaacatcaagtatttctatgat
atcacggacctcggagattttagggctaatcctgactacaaaggtgtttgccatgttgcg
cttgcacaagaaggtcattgcaggccaggagaggttttgttaggaacagactcacacaca
tgtactgctggagcattcggtcagtttgctacagggattggaaacactgatgcaggcttt
gtgttaggcactggaaaaatcctccttaaggttccaccaactatgaggtttatcttggat
ggtgaaatgcccagttatttgcaagcaaaggatctgattctgcagatcattggtgaaata
tctgttgctggtgcaacttacaagacgatggagttcagtggtacaactattgaaagtctg
actatggaagaacgaatgacattgtgcaacatggttgtggaagctgggggaaagaatggt
gtcatccctcctgatgcgacgacatttaattacgttgagaataggacatctgtacccttt
cagcctgtatatagtgatggaaatgcaagctttgtggcagattatagatttgatgtgtca
aagctagagcctgtggttgctaagcctcattctcctgataatcgtgctctagcgagagaa
tgcaaagatgtgaaaattgacagagtatacatcggttcttgtactggtgggaagaccgag
gattttatggctgcagctaaacttttccatgcagcaggaaagcaagtcaaagttccaact
ttccttgtcccggccactcagaaggtgtggatggacgtgtatgcactcccagtacctgga
gcgggtggaaagacatgtgcgcagatttttgaagaagctggatgtgacacaccaaccagt
cctagctgtggtgcctgccttggtggcccagcagacacctacgctcgtttgaatgaacct
caagtgtgtgtctcgacaacgaacaggaactttcccggtcggatgggacacaaagaaggg
cagatatacttggcttctccttacactgctgcagcctcggctctaaccggccatgtcacc
gacccaagagagttcttgcagtag

KEGG   Brassica napus (rape): 106433150
Entry
106433150         CDS       T04128                                 
Name
(RefSeq) 3-isopropylmalate dehydratase large subunit, chloroplastic
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00660  C5-Branched dibasic acid metabolism
bna00966  Glucosinolate biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    106433150
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106433150
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106433150
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     106433150
    4.2.1.35  (R)-2-methylmalate dehydratase
     106433150
SSDB
Motif
Pfam: Aconitase
Other DBs
NCBI-GeneID: 106433150
NCBI-ProteinID: XP_013729447
UniProt: A0A078I3L6
LinkDB
Position
A8:complement(6789362..6793666)
AA seq 504 aa
MASSVISSSPFLCKSAQKDLGFPKPSQISVHRCQKRAISRKIVSVMAPQRSSSATGSVKT
GMTMTEKILAKAAEKSQVVPGDNIWVNVDVLMTHDVCGPGAFGIFKREFGEKAKVWDPEK
IVVIPDHYIFTADKRANRNVDIMREHCREQNIKYFYDITDLGDFRANPDYKGVCHVALAQ
EGHCRPGEVLLGTDSHTCTAGAFGQFATGIGNTDAGFVLGTGKILLKVPPTMRFILDGEM
PSYLQAKDLILQIIGEISVAGATYKTMEFSGTTIESLTMEERMTLCNMVVEAGGKNGVIP
PDATTFNYVENRTSVPFEPVYSDGNASFIADYRFDVSKLEPVVAKPHSPDNRALARECKD
VKIDRVYIGSCTGGKTEDFMAAAKLFHAAGKQVKVPTFLVPATQKVWMDVYALPVPGAGG
KTCAQIFKEAGCDTPTSPSCGACLGGPADTYARLNEPQVCVSTTNRNFPGRMGHKEGQIY
LASPYTAAASALTGHVTDPREFLQ
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggcttcctctgtaatctcttcatctcctttcctctgcaaatccgcccagaaggatttg
gggttccctaaaccgtcgcagatttcggttcacagatgtcagaagagagcgatatctcgg
aagatcgtctccgtcatggcgccgcagcgatcatccagcgccactggatcggtgaaaact
gggatgacgatgacggagaagattcttgccaaggcagcagagaaatcacaagtggtgcct
ggtgataacatctgggttaacgttgacgttctcatgactcatgatgtctgtggccctggt
gcttttggtatcttcaagagagagttcggtgaaaaagctaaggtttgggacccggagaag
attgttgttattccagaccattacatcttcactgctgataagcgtgccaaccgcaatgtc
gacattatgagggaacattgcagggaacagaacatcaagtatttctatgatatcaccgac
cttggagattttcgggctaatcctgactacaaaggtgtttgccatgtggcgcttgcacaa
gaaggtcattgcaggccaggagaggttttgttaggaacagactcgcacacatgtactgct
ggagcgtttggtcagtttgctacagggattggaaacaccgatgctggatttgtgttaggc
actggcaaaatcctccttaaggttccaccaacaatgaggtttatcttggatggtgaaatg
cccagttatctgcaagcaaaggatctgattttacaaatcattggagaaatatctgttgct
ggtgcaacttacaagacgatggagttcagtggaacaactattgaaagtctaactatggaa
gaaagaatgacattgtgcaacatggttgtggaagctgggggaaagaatggtgtcatccct
cctgatgcgacgacatttaattacgttgagaacaggacatctgtaccctttgagcccgta
tatagtgatggaaatgcaagctttattgcagattatcgatttgacgtgtcaaagctggag
cctgtggtggctaagcctcattctcctgacaacagggctctagcaagagaatgcaaagat
gtgaaaattgacagagtatacattggttcttgtactggtgggaagactgaggattttatg
gctgcagctaaacttttccatgcagcaggaaagcaagtcaaagtcccaactttccttgtc
cccgctactcagaaggtgtggatggatgtgtatgccctccctgtgcctggagcaggtgga
aagacgtgtgcgcagatattcaaagaagctggctgcgacacacccaccagtcctagttgt
ggtgcctgccttggtggcccagctgacacctatgctcgcttgaatgaacctcaagtgtgt
gtctcgacaacgaacagaaactttcctggtcggatgggacacaaagaagggcagatttac
ttggcttctccttacaccgctgcagcctcggctctgaccggccatgtcaccgacccaaga
gagttcttgcagtag

KEGG   Brassica napus (rape): 106434492
Entry
106434492         CDS       T04128                                 
Name
(RefSeq) 3-isopropylmalate dehydratase small subunit 3
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00660  C5-Branched dibasic acid metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    106434492
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106434492
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     106434492
    4.2.1.35  (R)-2-methylmalate dehydratase
     106434492
SSDB
Motif
Pfam: Aconitase_C
Other DBs
NCBI-GeneID: 106434492
NCBI-ProteinID: XP_013730819
UniProt: A0A078IUI2
LinkDB
Position
C4:4263053..4264458
AA seq 255 aa
MAAASLRSVNPTLPRTLASPTRSPPFQSPFLRFAPASTTSFSNLKPLVTPPAPSSSPFVT
RSAAASPQERKTFHGLCYVVGDNIDTDQIIPAEFLTLVPSNPDEYQKLGSHALVGLPASY
EDRFVEPGETKTKYSIVIGGENFGCGSSREHAPVCLGAAGAKAVVAQSYARIFFRNSVAT
GEIYPLDSEVRVCDECRTGDVATVELREGDSVLINHTTGKEYRLKAIGDAGPVIDAGGIF
AYARKAGMIPSAAAA
NT seq 768 nt   +upstreamnt  +downstreamnt
atggcggcggcgtctctccgatctgtaaaccctacattaccccgaaccctagcgtctccc
acaaggtctcctcccttccaatcaccattcctcagattcgctcccgcctccaccacctcc
ttctccaacctcaaacccctcgtcactccccccgcaccatcctcctcccccttcgtcacc
cgctccgccgcagcctcgccgcaagagagaaagactttccacggcctctgctacgtcgtc
ggcgacaacatcgacacagaccagatcatccccgccgagttcctcaccctcgtcccctcc
aaccccgacgagtaccagaagctcggctcccacgcgctggtcggcctcccggcctcgtac
gaggaccggttcgtggagccgggggagacgaagacgaagtactcgatcgtcatcggcggg
gagaacttcgggtgcgggtcgtcgagggagcacgctccggtgtgcttgggagcggcgggg
gcgaaggcggtggtggcgcagtcgtacgcgaggatctttttcaggaactcggtggcgacc
ggggagatttatccgttggactcggaggttagggtgtgtgatgagtgtaggacgggggat
gtggcgacggtggagttgagggaaggggatagtgttttgattaatcatacgacggggaag
gagtataggcttaaggctattggtgacgctgggcctgtgattgatgctggtgggatcttt
gcgtatgcgaggaaggctgggatgattccttctgcagctgctgcttga

DBGET integrated database retrieval system