KEGG   Brassica napus (rape): 106432460
Entry
106432460         CDS       T04128                                 
Name
(RefSeq) dihydroxy-acid dehydratase, chloroplastic-like
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106432460
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106432460
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     106432460
SSDB
Motif
Pfam: ILVD_EDD FeoA
Other DBs
NCBI-GeneID: 106432460
NCBI-ProteinID: XP_013728754
LinkDB
Position
A1:24598407..24601528
AA seq 609 aa
MHATILSPRATLFPCKPLVPSYSRRRRRSTISCSVQPVTADPSPPPLTDSSKKLNKYSSR
ITEPKSQGGSQAILHGVGLSDGDLLKPQIGISSVWYEGNTCNMHLLKLSEAVKEGVEGAG
MVGFRFNTIGVSDAISMGTRGMCFSLQSRDLIADSIETVMSAQWYDANISIPGCDKNMPG
TIMAMGRLNRPGIMVYGGTIKPGHFQEKTYDIVSAFQSYGEFVGGSISDEQRKTVLHNAC
PGAGACGGMYTANTMASAIEAMGMSLPYSSSIPAEDPLKLDECRLAGKYLVELLKMDLKP
RDIITPKSLRNAMVTVMALGGSTNAVLHLIAIARSVGLELTLDDFQKVSDAVPFLADLKP
SGKYVMEDIHKIGGTPAVLRYLLEAGFMDGDCITVTGQTLAQNLENVPRLPENQVIIRPV
SNPIKETGHIQILRGDLAPEGSVAKITGKEGLYFSGPALVFEGEESMLAAISADPMSFKG
TVVVIRGEGPKGGPGMPEMLTPTSAIMGAGLGKECALLTDGRFSGGSHGFVVGHICPEAQ
EGGPIGLVKNGDIITIDIGKKRIDTQVSPEEMNERKKKWTAPAYKVNRGVLYKYIKNVQS
ASAGCVTDE
NT seq 1830 nt   +upstreamnt  +downstreamnt
atgcacgccactatcctctcaccacgcgccactctcttcccctgtaaacctctcgtccct
tcgtactctcgccgccgccgccgatcaaccatctcctgctccgtccaaccagtaaccgcc
gacccctcccctcctcccctcacagactcctccaagaagctcaacaagtacagctcgaga
atcacggagcccaagtcccaaggcgggtcgcaagccatcctccacggcgtgggcttgtcc
gacggcgatctgctgaagccccagatcgggatatcgtcggtctggtacgaagggaacacg
tgcaatatgcacctgctgaagctgtcggaggcggtgaaggagggagtagagggagctggg
atggtcgggtttaggttcaacacgatcggggtgagtgatgctatctcgatggggacgaga
gggatgtgtttcagtttgcagtcgagagacttgattgctgatagtatcgagactgtgatg
agtgctcagtggtatgatgccaacatctctatccctggttgtgataaaaatatgcctgga
acaattatggccatgggaaggcttaacagacctgggattatggtttatggtggaaccatc
aagcctggacactttcaagagaagacatatgacatagtatctgctttccagagttatgga
gaatttgttggtggctccataagcgatgagcagagaaagactgtccttcataatgcttgt
cctggagctggagcttgtggtggcatgtacactgctaacaccatggcttctgcaattgaa
gctatgggaatgtctcttccttacagctcttcgatacctgctgaagacccgttgaaactg
gacgagtgccggttagctggaaagtatcttgtagaattgctaaagatggacttgaagccc
cgtgacattatcactccaaaatcacttcgtaatgcgatggttactgtcatggctcttggt
ggatccaccaatgctgtactgcatcttattgctattgccaggtctgtgggtttggagctg
actcttgacgattttcagaaggttagcgatgctgttccgtttctagcagaccttaaacca
agtgggaaatatgttatggaagatatacataagattggaggtacaccagctgttcttcgt
tatctattagaagctggttttatggatggggattgtatcacagtcacagggcagacttta
gctcaaaatttagaaaacgtccctcgcttaccagaaaatcaggttataattagacctgtt
tcaaacccaatcaaagagactggacacatccaaatattgagaggagaccttgcaccagag
ggttctgtagcaaagattactggcaaagaagggttatatttctctggccccgcacttgta
tttgaaggagaggaatctatgctggctgctatatcagcagacccgatgagctttaaagga
acagtggttgttatcagaggagagggtcctaaaggaggtccaggcatgcctgagatgttg
acaccaactagtgcgataatgggtgccggtcttggaaaggaatgtgcattgctgactgat
ggtaggttctctggtggctcacacggttttgttgttggccacatttgccctgaagctcag
gagggtggtccaataggtctggtaaagaacggagacataatcacaattgacataggaaag
aagagaatagacacacaagtctcacccgaagaaatgaatgagcgtaaaaagaaatggact
gctcctgcatacaaggttaaccgcggagttctatacaagtacatcaagaacgtgcaatcg
gcttcagctggatgcgtgactgatgagtaa

KEGG   Brassica napus (rape): 106450576
Entry
106450576         CDS       T04128                                 
Name
(RefSeq) dihydroxy-acid dehydratase, chloroplastic-like isoform X1
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106450576
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106450576
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     106450576
SSDB
Motif
Pfam: ILVD_EDD FeoA
Other DBs
NCBI-GeneID: 106450576
NCBI-ProteinID: XP_013747709
LinkDB
Position
A7:3879898..3884840
AA seq 611 aa
MHATILSPRATLFPPHNVRSSNSLDSRRRRRSTVSCAAQPVTADPSPPLTDSSNKLNKYS
SRITEPKSQGGSQAILHGVGLSDDDLLKPQIGISSVWYEGNTCNMHLLQLSEAVKEGVEK
AGMVGFRFNTIGVSDAISMGTRGMCFSLQSRDLIADSIETVMSAQWYDGNISIPGCDKNM
PGTIMAMGRLNRPGIMVYGGTIKPGHFQEKTYDIVSAFQSYGEFVGGSISDEQRKTVLHN
ACPGAGACGGMYTANTMASAIEAMGMSLPYSSSIPAEDPLKLDECRLAGKYLIELLKMDL
KPRDIITPKSLRNAMVTVMALGGSTNAVLHLIAIARSVGLELTLDDFQKVSDAVPFLADL
KPSGKYVMEDIHKIGGTPAVLRYLLEAGFMDGDCITVTGQTLAQNLENVPRLPENQVIIR
PVSNPIKETGHIQILRGDLAPEGSVAKITGKEGLYFSGPALVFEGEESMLAAISADPMSF
KGTVVVIRGEGPKGGPGMPEMLTPTSAIMGAGLGKECALLTDGRFSGGSHGFVVGHICPE
AQEGGPIGLVENGDIITIDIGKKRIDTQVSAEEMNARRKKWTAPAYKVNRGVLYKYIKNV
QSASAGCVTDE
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgcacgccaccatcctctccccacgcgccactctcttccctccacacaatgtccgctcc
tccaacagcctcgactctcgccgccgccgccgatcaaccgtctcctgcgccgcccaaccc
gtaaccgccgacccctcccctcctctcacggactcctccaacaagctcaacaagtacagc
tcaagaatcaccgagcccaagtcccaaggcggctcccaagccatcctccacggcgtgggc
ttatccgacgacgatttgctgaaaccccagatcgggatttcctccgtgtggtacgaaggc
aacacctgcaatatgcatctgctccagctgtccgaggcggtgaaggagggagtggagaaa
gctgggatggttgggtttaggttcaacacgattggtgtgagtgatgctatctctatggga
accagagggatgtgtttcagtttgcagtctagagatttgattgctgatagtattgagact
gtgatgagcgctcagtggtatgatggcaacatctctatccctggttgtgataaaaatatg
cctggaactattatggccatgggaaggcttaacagacctgggattatggtttatggtgga
accatcaagccaggacattttcaagagaagacatatgacatagtatctgctttccagagt
tatggagaatttgttggtgggtctataagtgatgaacagagaaagactgtcctccataat
gcatgtcctggagctggagcctgtggtggcatgtacactgctaatacaatggcttctgca
atcgaagccatgggaatgtcccttccttacagctcttcaatacctgctgaagacccgttg
aagctggacgagtgccggttagctggaaaatatcttatagagttgctaaagatggacttg
aaaccgcgtgacattatcactcctaaatcacttcgtaatgcaatggtcacagtcatggct
cttgggggttcaaccaacgctgtgttgcatctaattgctattgccaggtctgtgggtttg
gagttgacccttgatgatttccagaaggtcagcgatgctgttccgtttctagcagacctt
aaaccaagtgggaagtatgttatggaagatatacataagattggtggcacgccagctgtt
cttcgttatctattagaagctggatttatggatggggattgtatcactgtcacagggcag
actttggctcaaaatttagaaaacgtccctcgtttaccagaaaaccaggttattatcaga
cctgtgtcaaacccaatcaaggagactggacacatccaaatcttgagaggagaccttgca
ccagagggttctgtagcaaaaataactggcaaagaagggttatatttctctggtcctgca
cttgtatttgaaggagaggaatctatgttggctgctatatcagcagacccgatgagtttt
aaaggaacagtggttgttatcagaggagagggtcctaaaggaggtccaggcatgccagag
atgttgacaccaacaagtgctattatgggtgccggtcttggaaaggaatgtgcattgctg
actgatggtaggttctcgggtgggtcacacggtttcgttgttggccatatttgtcctgag
gctcaggagggtggtccaattggtctggtagagaatggagacataatcacaatcgacata
ggaaagaagagaatagacacacaagtctcggccgaagagatgaatgcgcgaagaaagaaa
tggactgctcctgcttacaaggttaaccgtggagttctatacaagtacatcaagaatgtg
caatcggcttcagctggatgcgtgactgatgagtaa

KEGG   Brassica napus (rape): 106451505
Entry
106451505         CDS       T04128                                 
Name
(RefSeq) dihydroxy-acid dehydratase, chloroplastic
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106451505
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106451505
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     106451505
SSDB
Motif
Pfam: ILVD_EDD FeoA
Other DBs
NCBI-GeneID: 106451505
NCBI-ProteinID: XP_013748889
UniProt: A0A078I644
LinkDB
Position
C1:41451347..41454547
AA seq 605 aa
MHATILSPRATLFPSHNVHESRRRRSTISCSVQPVTADPSPPPLTDSKKLNKYSSRITEP
KSQGGSQAILHGVGLSDDDLLKPQIGISSVWYEGNTCNMHLLKLSEAVKEGVEGAGMVGF
RFNTIGVSDAISMGTRGMCFSLQSRDLIADSIETVMSAQWYDGNISIPGCDKNMPGTIMA
MGRLNRPGIMVYGGTIKPGHFQEKTYDIVSAFQSYGEFVGGSISDEQRKTVLHNACPGAG
ACGGMYTANTMASAIEAMGMSLPYSSSIPAEDPLKLDECRLAGKYLVELLKMDLKPRDII
TPKSLRNAMVTVMALGGSTNAVLHLIAIARSVGLELTLDDFQKVSDAVPFLADLKPSGKY
VMEDIHKIGGTPAVLRYLLEAGFMDGDCITVTGQTLAQNLENVPRLPENQVIIRPVSNPI
KETGHIQILRGDLAPEGSVAKITGKEGLYFSGPALVFEGEESMLAAISADPMSFKGTVVV
IRGEGPKGGPGMPEMLTPTSAIMGAGLGKECALLTDGRFSGGSHGFVVGHICPEAQEGGP
IGLVKNGDIITIDIGKKRIDAQVSPEEMNERRKKWTAPAYKVNRGVLYKYIKNVQSASAG
CVTDE
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgcacgccacaatcctctcaccacgcgccacactcttcccttcacacaatgtccacgaa
tctcgccgccgccgttcaaccatctcctgctccgtccaacccgtaaccgccgacccctct
cctcctcccctcacagactccaagaagctcaacaagtacagctcgagaatcacggagccc
aagtcccaaggcgggtcacaagccatcctccacggcgtgggcctatccgacgacgatctg
ctgaaaccccagatcgggatatcgtcggtttggtacgaagggaacacgtgcaacatgcat
ctgctgaagctgtcggaggcggtgaaggagggagtggagggagctgggatggttgggttt
aggttcaatacgatcggggtgagtgatgcgatctcgatggggacgagggggatgtgtttc
agtttgcagtctagagatttgattgctgatagtattgagactgtgatgagtgctcagtgg
tatgatggcaacatctctatccctggttgtgataaaaatatgcctggaacaattatggct
atgggaaggcttaacagacctgggattatggtttatggtggaaccatcaagcctggacac
tttcaagaaaagacatatgacatagtatctgctttccagagttatggagaatttgttggt
ggctctataagtgatgaacagagaaagactgtccttcataatgcttgtcctggagctgga
gcttgtggtggcatgtacacagctaataccatggcttctgcaattgaagctatgggaatg
tctcttccttacagctcttcgatacctgctgaagacccgttgaaactggacgagtgccgg
ttagctggaaagtatcttgtagaattgctaaagatggacttgaagccccgtgacattatc
actccaaaatcacttcgtaatgcgatggttactgtcatggctcttgggggatccaccaac
gctgtattgcatcttattgctattgccaggtctgtgggtttggagttgacccttgacgat
ttccagaaggtcagcgatgcggttccgtttctagcagaccttaaaccaagtgggaaatat
gttatggaagatatacataagattggtggcacaccagctgttcttcgttatctattagaa
gctggttttatggatggggattgtatcacagtcacagggcagactttggctcaaaattta
gaaaacgtccctcgcttaccagaaaatcaggttataattagacctgtgtcaaacccaatc
aaagagactggacacatccaaatcttgagaggggaccttgcaccagagggttctgtagca
aagataactggcaaagaagggttatatttctctggccccgcacttgtatttgaaggagag
gaatctatgctggctgctatatcagcagacccgatgagctttaaaggaacagtagttgtt
atcagaggagaaggtcctaaaggaggtccaggcatgcctgagatgttgacaccaactagt
gcgataatgggtgccggtcttggaaaggaatgtgcattgctgactgatggtaggttctct
ggtggctcacacggttttgttgttggccacatttgccctgaagctcaggagggtggtcca
ataggtctggtaaagaacggagacataatcacaattgacataggaaagaagagaatagac
gcacaagtgtcacccgaagaaatgaatgagcgtagaaagaaatggactgctcctgcatac
aaggttaaccgcggagttctatacaagtacatcaagaacgtgcaatcggcttcagctgga
tgcgtgactgatgagtaa

KEGG   Brassica napus (rape): 106452467
Entry
106452467         CDS       T04128                                 
Name
(RefSeq) dihydroxy-acid dehydratase, chloroplastic
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
bna  Brassica napus (rape)
Pathway
bna00290  Valine, leucine and isoleucine biosynthesis
bna00770  Pantothenate and CoA biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bna_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    106452467
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    106452467
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     106452467
SSDB
Motif
Pfam: ILVD_EDD FeoA
Other DBs
NCBI-GeneID: 106452467
NCBI-ProteinID: XP_013750053
UniProt: A0A078I8W0
LinkDB
Position
C7:45436042..45439405
AA seq 611 aa
MHATILSPRATLFPPHNVRSSNTLDSRRRRRPTFSCAAQPVTADPSPPLTDSSNKLNKYS
SRITEPKSQGGSQAILHGVGLSDDDLLKPQIGISSVWYEGNTCNMHLLRLSEAVKEGVEK
AGMVGFRFNTIGVSDAISMGTRGMCFSLQSRDLIADSIETVMSAQWYDGNISIPGCDKNM
PGTIMAMGRLNRPGIMVYGGTIKPGHFQEKTYDIVSAFQSYGEFVGGSISDEQRKTVLHN
ACPGAGACGGMYTANTMASAIEAMGMSLPYSSSIPAEDPLKLDECRLAGKYLVELLKMDL
KPRDIITPKSLRNAMVTVMALGGSTNAVLHLIAIARSVGLELTLDDFQKVSDAVPFLADL
KPSGKYVMEDIHKIGGTPAVLRYLLEAGFMDGDCITVTGQTLAQNLENVPRLPENQVIIR
PVSNPIKETGHIQILRGDLAPEGSVAKITGKEGLYFSGPALVFEGEESMLAAISADPMSF
KGTVVVIRGEGPKGGPGMPEMLTPTSAIMGAGLGKECALLTDGRFSGGSHGFVVGHICPE
AQEGGPIGLVENGDIITIDIGKKRIDTQVSAEEMNARRKKWTAPAYKVNRGVLYKYIKNV
QSASAGCVTDE
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgcacgccaccatcctctccccacgcgccactctcttccctccacacaatgtccgctcc
tccaacaccctcgactctcgccgccgccgccgaccaaccttctcctgcgccgcccaaccc
gtaaccgccgacccctcccctcctctcacggactcctccaacaagctcaacaagtacagc
tcaagaatcaccgagcccaagtcccaaggcggctcacaagccatcctccacggcgtgggc
ttatccgacgacgatttgctgaaaccccagatcgggatttcctccgtgtggtacgaaggc
aacacctgcaatatgcatctgctccggctgtccgaggcggtgaaggagggagtggagaaa
gctgggatggttgggtttaggttcaacacgattggtgtgagtgatgctatctctatggga
accagagggatgtgtttcagtttgcagtctagagatttgattgctgatagtattgagact
gttatgagcgctcagtggtatgatggcaacatctctattcctggttgtgataaaaatatg
cctggaactattatggccatgggaaggcttaacagacctgggattatggtttatggtgga
accatcaagccaggacattttcaagagaagacatatgacatagtatctgctttccagagt
tatggagaatttgttggtgggtccataagtgatgaacagaggaagactgtcctccataac
gcgtgtcctggagctggagcctgtggtggcatgtacactgctaatacaatggcttctgca
atcgaagccatgggaatgtcccttccttacagctcttcaatacccgctgaagacccgtta
aagctggacgagtgccggttagccggaaaatatcttgtagaattgctaaagatggacttg
aaaccccgtgacattatcactcctaaatcacttcgtaatgcgatggtcacagtcatggct
cttgggggatcaaccaacgctgtattgcatttaattgctattgccaggtctgtgggtttg
gagttgacccttgacgatttccagaaggtcagcgacgctgttccatttctagcagacctt
aaaccaagtgggaagtatgttatggaagatatacataagattggtggaacaccagctgtt
cttcgttatctattagaagctggatttatggatggggattgtatcactgtcacagggcag
actttggctcagaatttggaaaacgtccctcgcttaccagaaaaccaggttataattaga
cctgtgtcaaacccaatcaaggagactggacacattcaaatcttgagaggagaccttgca
ccagagggttctgtagcaaagataaccggcaaagaagggttatatttctctggtcctgca
cttgtatttgaaggagaggaatctatgttggctgctatatcagcagacccgatgagtttt
aaaggaacagtggttgttatcagaggagagggtcctaaaggaggtccaggcatgcctgag
atgttgacaccaactagtgctataatgggtgccggtcttggaaaggaatgtgcattgctg
actgatggtaggttctcgggtgggtcacacggtttcgttgttggccacatttgtcctgag
gctcaggaaggtggtccaattggtctggtagagaatggagacataatcacaatcgacata
ggaaagaagagaatagacacacaagtctcggccgaagagatgaatgcgcgaagaaagaaa
tggactgctcctgcttacaaggttaaccgcggagttctatacaagtacatcaagaatgtg
caatcggcttcagctggatgcgtgactgatgagtag

DBGET integrated database retrieval system