Bombella sp. ESL0368: GN304_07640 Help Entry GN304_07640       CDS       T06372                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism bob  Bombella sp. ESL0368 Pathway bob02024   Quorum sensing bob03018   RNA degradation Brite KEGG Orthology (KO) [BR:bob00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     GN304_07640 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     GN304_07640 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bob03019]     GN304_07640 (hfq)    03036 Chromosome and associated proteins [BR:bob03036]     GN304_07640 (hfq) Messenger RNA biogenesis [BR:bob03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      GN304_07640 (hfq) Chromosome and associated proteins [BR:bob03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     GN304_07640 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  QGT75608 LinkDB All DBs Position complement(1698077..1698304) Genome browser AA seq 75 aa AA seqDB search MSEQRTGDVQEQFLAHVQQREEPVTVFLVNGVKLQGVITRFDGRSVLLRRDGHVQLVYKH AISTIMPVAALSDLP NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtcagaacagagaacaggcgacgtgcaggagcagtttctggcccatgtgcagcagcgg gaagaaccggtgacggtttttctggtcaatggtgtcaagcttcagggggtcatcacacgg tttgatggtcgcagtgtgctgctccgccgggacgggcatgtgcagctcgtctacaaacat gcgatcagcaccatcatgcccgtggcggctctttcggacctgccctga

DBGET integrated database retrieval system