Bactrocera oleae (olive fruit fly): 118681391 Help Entry 118681391         CDS       T07646                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism bod  Bactrocera oleae (olive fruit fly) Pathway bod03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:bod00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     118681391  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bod03036]     118681391   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bod04147]     118681391 Chromosome and associated proteins [BR:bod03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118681391 Exosome [BR:bod04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118681391 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  118681391 NCBI-ProteinID:  XP_036221608 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT EKKA NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgtctgggcgtggtaaaggaggtaaagtgaagggaaaagcaaagtcgcgttcaaatcgt gctggtcttcaatttcccgtcggacgtatacaccgtttgttgcgcaaaggcaattatgcc gaacgtgttggtgctggtgctcccgtatatttagctgctgttatggaatatttggctgct gaagttcttgaattggctggtaatgctgcccgtgataacaaaaagactagaataattcca cgtcatttacaattggccatccgtaatgacgaagaattgaataaattattatctggagtg actattgctcaaggtggtgttttgccaaacattcaagctgtacttttaccaaagaagact gagaaaaaagcataa

DBGET integrated database retrieval system