KEGG   Brassica oleracea (wild cabbage): 106296616
Entry
106296616         CDS       T04124                                 
Name
(RefSeq) cytosolic sulfotransferase 16-like
  KO
K11821  aromatic desulfoglucosinolate sulfotransferase [EC:2.8.2.24]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00380  Tryptophan metabolism
boe00966  Glucosinolate biosynthesis
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
boe01210  2-Oxocarboxylic acid metabolism
Module
boe_M00370  Glucosinolate biosynthesis, tryptophan => glucobrassicin
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    106296616
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106296616
Enzymes [BR:boe01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.24  aromatic desulfoglucosinolate sulfotransferase
     106296616
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3
Other DBs
NCBI-GeneID: 106296616
NCBI-ProteinID: XP_013588248
UniProt: A0A0D3D0J3
LinkDB
Position
C6:complement(36907526..36908797)
AA seq 338 aa
MEPNTTQNGSQLELSEFEKTQKKYQDFISALPKSKGWRPNEILTQYNGHWWQECLLEGLL
HAKDHFQARPTDFLVCSYPKTGTTWLKALTYAIVNRSRFDDATNPLLKRNPHEFVPYVEI
DFAFYPTVGVLQDGKNQLYSTHIPNGSLPESIVKSGCKMVYIWRDPKDTFISMWTFLHKE
KSQEGQQLASLEEAFDMFCKGLSVYGPYLDHVLGYWKAYKENPERILFLRYETMRANPLP
FVKRLAEFMGYGFSAEEEEKRVAENVVKLCSFETLKNLEANKGDKEREDRPAVYANSAYF
RKGKVGDWSNYLTPEMAARIDGLVEETFKDTGLLQHDQ
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggaacccaacacgacccaaaacggatcccaactcgagctctcagagttcgagaagacc
caaaagaagtaccaagacttcatctccgccctcccaaagagcaaaggatggagaccaaac
gagatcctaacccaatacaacggacactggtggcaagaatgtctcctcgaaggtctcctc
cacgccaaagaccatttccaagcacgacccaccgacttcctcgtctgcagctaccctaaa
accggcacaacctggctcaaggcactaacgtacgccatcgtaaaccgatctcgtttcgac
gacgccacgaacccgctcctcaaacgtaaccctcacgagttcgtgccttacgtcgagata
gacttcgctttctacccaaccgtcggcgtacttcaagacggcaagaaccagctttactcc
acccatatacccaacgggtcgttaccagagtccatcgtgaagtccggttgcaagatggtt
tacatttggagagacccgaaggacactttcatctccatgtggactttcctccacaaggag
aagtctcaagagggtcagcagctagcgagtcttgaagaggcttttgatatgttctgtaaa
ggcttgtctgtctacggtccttatctggaccatgtgttgggttactggaaggcttacaaa
gagaacccggagaggattctgttccttaggtacgagacgatgagagctaatcctttgcct
tttgtgaagaggttggctgagttcatgggttatggattcagtgccgaggaagaggagaag
cgtgttgctgagaatgtggtgaagctttgcagcttcgagacgttgaagaatcttgaagct
aacaaaggagataaggagagagaagatcgccctgctgtttacgcgaatagcgcgtatttt
aggaaaggaaaggttggagattggtcgaattatctgactccggagatggctgctcgtatc
gatgggttagtggaagagactttcaaagatactggcttgcttcaacatgatcagtga

DBGET integrated database retrieval system