KEGG   Brassica oleracea (wild cabbage): 106312180
Entry
106312180         CDS       T04124                                 
Name
(RefSeq) cytochrome P450 83B1
  KO
K11818  aromatic aldoxime N-monooxygenase [EC:1.14.14.45]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00380  Tryptophan metabolism
boe00966  Glucosinolate biosynthesis
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
boe01210  2-Oxocarboxylic acid metabolism
Module
boe_M00370  Glucosinolate biosynthesis, tryptophan => glucobrassicin
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    106312180
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106312180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:boe00199]
    106312180
Enzymes [BR:boe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.45  aromatic aldoxime N-monooxygenase
     106312180
Cytochrome P450 [BR:boe00199]
 Cytochrome P450, plant type
  CYP83 family
   106312180
SSDB
Motif
Pfam: p450 Goodbye Transposase_31 FANCI_S2
Other DBs
NCBI-GeneID: 106312180
NCBI-ProteinID: XP_013605048
UniProt: A0A0D3DKE8
LinkDB
Position
C8:complement(6341910..6343791)
AA seq 499 aa
MDLFLIIAAMVAVAAFFLLRSSTKKSLRLPPGPKGLPIIGNLHQMEKFNPQHFLFRLSKL
YGPIFTMKIGGRRLAVISSAKLAKELLKTQDLNFTARPLLKGQQTMSYQGRELGFGQYTA
YYREMRKMCMVNLFSPNRVASFRPVREEECQRMMEKIYKAADQSGTVDLSELLLSFTNCV
VCRQAFGKRYNEYGTEMKRFINILYETQALLGTLFFSDLFPYFGFLDNLTGLSARLKRAF
KELDTYLQELLDETLDPSRPKPETESFIDLLMQIYKDQPFSIKFTHENVKAMILDIVVPG
TDTAAAVVVWAMTYLIKYPEAMKKAQDEVRNVVGDKGYVSEEDIPNLPYLKAVIKESLRL
EPVIPILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDNPNEFIPERFMNEQK
GVDFKGQDFELLPFGSGRRMCPAMHLGVAMVEIPFANLLYRFDWSLPTGIKPEDIKMDVM
TGLAMHKKDHLVLAPRTHI
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggatctcttcttgattattgccgccatggtagcagtcgcagccttcttcctcctccgg
agctccacgaagaaatctctccggctgcctccggggccaaaaggtcttcctattattgga
aacctccaccagatggagaaatttaacccccaacacttcctctttcgtctctccaagctc
tacggtccaattttcacaatgaaaatcggtggacgccgccttgcagtgatctcatcggct
aagttagccaaggaactcctcaagacccaggacctcaatttcaccgctcgtcctctcctg
aaggggcaacaaacgatgtcatatcaaggtcgtgagcttggtttcggacagtacacagcg
tactatcgtgagatgaggaagatgtgtatggttaacctattcagcccaaatcgcgtcgca
agtttccgacccgttagagaagaagagtgccaacgtatgatggaaaagatctacaaagcc
gctgatcaatcagggaccgttgatttaagtgagcttctcttgtcattcaccaactgtgtc
gtctgtagacaagcttttggtaagcggtataacgagtacggaaccgagatgaagagattc
ataaacatcttgtacgagactcaagcccttttgggcactctgtttttctccgaccttttc
ccttatttcggatttcttgacaatctcactggtcttagtgcgcgtctcaagagagctttc
aaggagctcgacacttaccttcaagaactcctcgatgagactcttgaccctagccgccct
aaacctgagacggagagtttcattgatcttttgatgcagatctacaaagatcaacctttc
tccatcaaatttacccacgaaaatgtcaaggccatgatattggatattgttgtaccggga
actgacactgcggcagcagtggtcgtatgggccatgacttaccttataaagtaccctgaa
gcaatgaagaaagctcaagatgaagtgaggaatgtggtcggtgacaaaggatacgtctcc
gaagaagacatccccaatctcccttatctgaaggccgtcatcaaggagtcactccgtctc
gaaccagtcatcccaattcttctacatagagaaaccatagcagacgcaaagataggtggc
tatgatattccggcgaagaccatcattcaggtgaacgcatgggcggtttctcgtgacaca
gccgcctggggagacaaccctaatgagttcattccagagaggttcatgaacgagcagaaa
ggagtggacttcaaggggcaagattttgagctcctacctttcgggtcaggcagaagaatg
tgccccgctatgcatcttggagtcgcaatggtagagataccttttgctaaccttctctac
cgattcgattggagcctaccgacagggattaaacctgaggacataaagatggacgtcatg
accggactcgctatgcataagaaagatcacctcgtccttgcaccaaggacgcacatttga

DBGET integrated database retrieval system