KEGG   Brassica oleracea (wild cabbage): 106313559
Entry
106313559         CDS       T04124                                 
Name
(RefSeq) cystine lyase CORI3-like
  KO
K21623  L-cystine beta-lyase [EC:4.4.1.35]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00270  Cysteine and methionine metabolism
boe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    106313559
Enzymes [BR:boe01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.35  L-cystine beta-lyase
     106313559
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_3
Other DBs
NCBI-GeneID: 106313559
NCBI-ProteinID: XP_013606861
UniProt: A0A0D3A5M6
LinkDB
Position
C1:10859646..10862043
AA seq 424 aa
MATTPMCTEWQFSGNEAAKEAAAAALGAYTSKLMALCDPNGKPILPPSNKAVETSNSAEK
AVVKVILSGTGNAYAPSIGLPLAKSAVAEYLNRDLPKKLTAADVFMTVGCKRAIDLAVDI
LAKPKANVLLPRPGFPWDVVRSIYKNLEVRYYDFIPEQNFEIDFESVKKVTDKNTFAIFI
INPHNPNGNTYSEAHLKQLAELAKELSIMVVSDEVFRWTVFGNNPFVPMGKFSSIVPVVT
LGSLSKGWNVPGWRTGWLALHDLDGVFRNTKILQAANEFLQINAKPPTVIQAAMPDILER
TPKHFFHERGSFLKHKVDIGYSKVKHIPGLTCYMKPEACTFLWTKLDISCFADIEDDQDF
CRKLAMEENLVVLPGIAFRQKNWLRHSIDMETPTVEDAFERLKSFCERHSAERGASLKNV
NGVN
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggcgaccacccccatgtgcactgagtggcagttcagcgggaacgaggcagccaaagaa
gctgctgcggccgccctaggtgcctacacctctaaactcatggctctttgtgatcctaat
ggcaagcccattttgcccccgagtaacaaggccgtggagaccagcaattcagcggaaaaa
gctgtcgttaaagttattctctccggcactggaaacgcctatgctcctagcattggcctt
ccgctcgccaaaagtgccgtagcagagtatctaaacagagatcttccaaagaagctaaca
gcagctgacgtgtttatgactgttggatgcaaacgagcaattgaccttgcggtggatatt
ctggctaaaccaaaagccaacgttttgcttccgaggccaggcttcccgtgggatgtagta
cgctccatctacaagaacctcgaggtccgttactatgatttcatccctgaacaaaacttt
gagatcgacttcgaaagcgtcaaaaaggtgacagacaagaacacctttgctatatttatc
atcaaccctcacaatcccaatggaaacacttactcggaggctcatctcaaacagctcgct
gaattggctaaggaactctcgattatggtggtttctgatgaagtttttagatggaccgtc
ttcgggaataacccttttgtgccgatgggaaagttttcttccatcgtaccagtggttaca
ctcggatccttatctaagggatggaatgtcccaggatggcgaactggctggctcgcgctg
cacgatctagacggtgtcttcagaaacactaagatattacaagctgccaacgaatttctc
cagataaatgccaaacctccgactgttattcaggcggctatgcctgacattttggagaga
actccaaaacatttcttccacgagaggggaagttttctgaaacataaagtagatattgga
tattctaaggtcaagcacatacctggcctcacttgttacatgaaacccgaagcgtgcacc
tttttatggaccaagctggatatatcgtgctttgctgacattgaagacgatcaagacttc
tgcaggaagcttgctatggaagaaaatctcgtcgttttgccagggattgcatttaggcag
aagaattggctgaggcattctatcgacatggagacgccaacagttgaggacgcatttgaa
agattgaagagcttctgtgaacgccattccgctgaacgtggagcttcactcaaaaacgtc
aatggcgtgaactag

DBGET integrated database retrieval system