KEGG   Brassica oleracea (wild cabbage): 106342466
Entry
106342466         CDS       T04124                                 
Name
(RefSeq) cytochrome P450 83A1
  KO
K12156  (methylthio)alkanaldoxime N-monooxygenase [EC:1.14.14.43]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00966  Glucosinolate biosynthesis
boe01110  Biosynthesis of secondary metabolites
boe01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    106342466
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:boe00199]
    106342466
Enzymes [BR:boe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.43  (methylsulfanyl)alkanaldoxime N-monooxygenase
     106342466
Cytochrome P450 [BR:boe00199]
 Cytochrome P450, plant type
  CYP83 family
   106342466
SSDB
Motif
Pfam: p450 PCP_red
Other DBs
NCBI-GeneID: 106342466
NCBI-ProteinID: XP_013636864
UniProt: A0A0D3BYX6
LinkDB
Position
C4:33688663..33690538
AA seq 501 aa
MEDIIIGVVALAAVLLFFLSQKSKTKRYKLPPGPRGLPVIGNLHQLSQLNPQRFFYGWAK
KYGPIFSYKIGSQTMVVISSAELTKELLKTQDVNFANRPQHRGHEFITYGRSDMAMNHYT
PYYREMRKMGMNHLFSPTRVATFKHVREEEARTMMVKVEKAAERAEPVDISELMLTFTNS
VVCRQAFGKKYNEDGEEMKRFIKILYGTQSVLGKIFFSDFFPLFGFLDDWTGLTAYMMEC
FERQDTYIQEIIDETLDPNRAKPETESMIDLLMEIYKDQPFASKFTIENVKGVILNIVVA
GTDTAAAAVVWGMTYLMKYPQVMKKAQAEVRKYAREKGSTFITEDDVKNLPYFRALVKET
LRIEPVIPLLIPRACIQDTKIAGYDIPAGTTVNVNAWAVSRDEKEWGPNPDEFKPERFLE
KDVDFKGTDYEFIPFGSGRRMCPGMRLGAAMLEVPFANLLLNFNFKLPNGMKPEEINMDV
MTGLAMHKSDHLKLVPEKVSK
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggaagatatcatcatcggggtggtggctctcgccgcggttctcctcttcttcctctct
caaaaatcaaaaaccaaacgctacaaactgcctcccggcccacggggacttccggtgatc
ggaaacctccaccagcttagccagcttaacccacaacgtttcttctatggatgggccaaa
aaatacggtccaatcttttcatacaagataggaagtcaaacaatggtggtcatatcatca
gctgagctaacaaaagagcttctcaagacgcaagatgtcaacttcgcgaaccggcctcag
caccgtggtcacgagttcataacctacggccgaagcgacatggcaatgaaccactacaca
ccgtattaccgggagatgaggaagatgggaatgaaccacttgttctcacccacacgtgtg
gccaccttcaagcacgtgcgggaggaggaggctaggacgatgatggttaaggtcgaaaag
gctgccgagagagccgaacctgtcgatataagcgagcttatgttgaccttcacgaactcg
gttgtgtgcaggcaagcgttcgggaagaagtacaatgaagatggggaagagatgaagaga
ttcatcaagattctttatggcactcaaagcgttttggggaagatttttttctccgatttt
ttcccgttattcggatttctagatgattggacaggtctcacggcttatatgatggagtgt
ttcgaaagacaagacacttatatacaggagattatcgatgagacacttgaccccaacagg
gccaagccagaaactgagagcatgatcgatctcttgatggagatctataaagatcaacct
ttcgcctccaagttcactatagagaatgtcaaaggcgtgattttgaatatagttgttgcg
ggaactgacacggcggctgcggcggttgtatggggaatgacgtatttgatgaagtatcct
caagtgatgaagaaagctcaggcagaagtgagaaagtatgcaagagagaaaggttcaacg
ttcattactgaagacgacgtgaagaaccttccttacttcagagccttggttaaagaaacc
ttaaggatcgaacctgtgattcctctccttatccctcgtgcttgcattcaagacaccaag
atcgctggttacgacatccctgcggggactactgtcaacgtcaacgcatgggccgtgtcc
cgcgacgagaaagagtggggccctaaccctgacgagttcaaaccagagaggtttcttgag
aaggacgttgacttcaaaggcacggactacgagtttataccgttcggatcaggccggaga
atgtgccctggaatgcgcctcggtgcggcgatgcttgaggttccgttcgcgaaccttctc
ctcaacttcaacttcaaacttcccaacggaatgaaaccagaagagatcaacatggatgtc
atgactggtcttgctatgcacaagtcggatcatctcaagcttgttccggagaaagtgagc
aagtaa

DBGET integrated database retrieval system