Bos mutus (wild yak): 102285279 Help Entry 102285279         CDS       T02919                                  Name (RefSeq) putative histone H2B type 2-D   KO K11252   histone H2B Organism bom  Bos mutus (wild yak) Pathway bom04613   Neutrophil extracellular trap formation bom05034   Alcoholism bom05203   Viral carcinogenesis bom05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bom00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102285279  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102285279   09163 Immune disease    05322 Systemic lupus erythematosus     102285279   09165 Substance dependence    05034 Alcoholism     102285279  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bom03036]     102285279   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     102285279 Chromosome and associated proteins [BR:bom03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102285279 Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102285279 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF MMS22L_C Motif Other DBs NCBI-GeneID:  102285279 NCBI-ProteinID:  XP_005904350 LinkDB All DBs Position Un AA seq 111 aa AA seqDB search MAVSAAGTHSSGNNKVKVDSKLITLLKKAMTKAQKKDGKKCKSSRKESYSVYVYKVLKQV HPDTGISSKAMGIMNCFVNDIFECIAGEASRLAHYNKHSTITSGRSRPPCA NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggctgtgagtgctgcagggacccacagttcaggcaacaacaaggttaaagtggacagc aagctgatcacactacttaaaaaagctatgaccaaggcccagaagaaggacggcaagaag tgcaagagcagccgcaaggagagctactccgtgtatgtgtacaaggtgctgaagcaagtc catccggacaccggcatctcgtccaaggccatgggaatcatgaactgcttcgtcaacgac attttcgagtgcatcgctggcgaggcatcgcgcctggcacattacaacaagcactcgact atcacatccgggagatccagaccgccgtgcgcttga

DBGET integrated database retrieval system