KEGG   Bos mutus (wild yak): 102285876
Entry
102285876         CDS       T02919                                 
Symbol
RIMKLA
Name
(RefSeq) ribosomal modification protein rimK like family member A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00250  Alanine, aspartate and glutamate metabolism
bom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102285876 (RIMKLA)
Enzymes [BR:bom01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     102285876 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     102285876 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp CPSase_L_D2 Dala_Dala_lig_C Synapsin_C Rimk_N TTL
Other DBs
NCBI-GeneID: 102285876
NCBI-ProteinID: XP_005889031
UniProt: A0A6B0RLJ2
LinkDB
Position
Un
AA seq 391 aa
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTIVGGNLGLQLNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKGVFLARDKHHLSDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYTM
SLLPNRQTGKMAVLPGLASPREKKEPDGCASAQGVAESVYAINSGSTSSESEPELGEIRA
SSASTAGAPAPMLPDPSYNINTRIASELKLK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgacggaccggcgcatccgcgaggactacccgcaggtg
cagatcctgcgcgccctccggcagcgctgctccgagcaggacgtgcgcttccgggcggtg
ctcatggaccagatcgccgtcaccatcgtcggcggcaacctcggcctgcagctgaaccag
aaggcgctcaccactttcccagacgtggtgcttgtccgcgtgcccacgccctccgtgcag
tcggacagtgacatcaccgtcctgcgacacctggagaagctgggttgccgcttagtcaac
cgcccacagagcattctaaactgcatcaacaaattctggacattccaggagctggctggg
catggggtccccatgccagacaccttctcctatggtggacatgaagacttttcgaaaatg
atcgatgaagccgagccgctgggctaccccgtggtggtgaagagcacgcgcggacaccgg
ggaaaaggtgtttttcttgcaagagataaacaccacctctcagacatctgccacctgatc
cgccacgacgtgccctacctgttccagaagtacgtgaaggagtcccacggaaaagatatc
cgggtggtggtggtcggcggccaggtgataggctccatgcttcgctgctccacagatgga
cggatgcagagcaactgctctcttggtggcgtgggcgtcatgtgcccgctgacggaacaa
ggcaagcagctggctatccaggtgtctaacatcctgggcatggacttctgtggcatcgat
cttctcatcatggacgatggctccttcgtggtgtgtgaggcaaatgccaacgtgggcttc
ctagccttcgaccaggcatgcaacttagacgtgggcgggatcattgcagactacaccatg
tccttgctgcccaacaggcagaccgggaagatggccgtcctcccaggcttggctagcccc
agggagaagaaagagccagatggctgtgcttcagctcagggagttgcagagagcgtctat
gccatcaacagcgggtctacctccagcgagagtgagcctgaactgggagagatccgggct
tcctcagccagcacagcgggggccccggcccccatgctgcctgaccccagctacaacatt
aacaccaggattgcttcagaattaaaacttaagtga

DBGET integrated database retrieval system