Bos mutus (wild yak): 102287414 Help Entry 102287414         CDS       T02919                                  Symbol GNAQ Name (RefSeq) G protein subunit alpha q   KO K04634   guanine nucleotide-binding protein G(q) subunit alpha Organism bom  Bos mutus (wild yak) Pathway bom04015   Rap1 signaling pathway bom04020   Calcium signaling pathway bom04022   cGMP-PKG signaling pathway bom04062   Chemokine signaling pathway bom04071   Sphingolipid signaling pathway bom04261   Adrenergic signaling in cardiomyocytes bom04270   Vascular smooth muscle contraction bom04371   Apelin signaling pathway bom04540   Gap junction bom04611   Platelet activation bom04713   Circadian entrainment bom04720   Long-term potentiation bom04723   Retrograde endocannabinoid signaling bom04724   Glutamatergic synapse bom04725   Cholinergic synapse bom04726   Serotonergic synapse bom04728   Dopaminergic synapse bom04730   Long-term depression bom04750   Inflammatory mediator regulation of TRP channels bom04911   Insulin secretion bom04912   GnRH signaling pathway bom04915   Estrogen signaling pathway bom04916   Melanogenesis bom04918   Thyroid hormone synthesis bom04921   Oxytocin signaling pathway bom04922   Glucagon signaling pathway bom04924   Renin secretion bom04925   Aldosterone synthesis and secretion bom04927   Cortisol synthesis and secretion bom04928   Parathyroid hormone synthesis, secretion and action bom04929   GnRH secretion bom04934   Cushing syndrome bom04935   Growth hormone synthesis, secretion and action bom04961   Endocrine and other factor-regulated calcium reabsorption bom04970   Salivary secretion bom04971   Gastric acid secretion bom04972   Pancreatic secretion bom05010   Alzheimer disease bom05016   Huntington disease bom05017   Spinocerebellar ataxia bom05022   Pathways of neurodegeneration - multiple diseases bom05135   Yersinia infection bom05142   Chagas disease bom05143   African trypanosomiasis bom05146   Amoebiasis bom05163   Human cytomegalovirus infection bom05170   Human immunodeficiency virus 1 infection bom05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102287414 (GNAQ)    04371 Apelin signaling pathway     102287414 (GNAQ)    04020 Calcium signaling pathway     102287414 (GNAQ)    04071 Sphingolipid signaling pathway     102287414 (GNAQ)    04022 cGMP-PKG signaling pathway     102287414 (GNAQ)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04540 Gap junction     102287414 (GNAQ)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102287414 (GNAQ)    04062 Chemokine signaling pathway     102287414 (GNAQ)   09152 Endocrine system    04911 Insulin secretion     102287414 (GNAQ)    04922 Glucagon signaling pathway     102287414 (GNAQ)    04929 GnRH secretion     102287414 (GNAQ)    04912 GnRH signaling pathway     102287414 (GNAQ)    04915 Estrogen signaling pathway     102287414 (GNAQ)    04921 Oxytocin signaling pathway     102287414 (GNAQ)    04935 Growth hormone synthesis, secretion and action     102287414 (GNAQ)    04918 Thyroid hormone synthesis     102287414 (GNAQ)    04928 Parathyroid hormone synthesis, secretion and action     102287414 (GNAQ)    04916 Melanogenesis     102287414 (GNAQ)    04924 Renin secretion     102287414 (GNAQ)    04925 Aldosterone synthesis and secretion     102287414 (GNAQ)    04927 Cortisol synthesis and secretion     102287414 (GNAQ)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102287414 (GNAQ)    04270 Vascular smooth muscle contraction     102287414 (GNAQ)   09154 Digestive system    04970 Salivary secretion     102287414 (GNAQ)    04971 Gastric acid secretion     102287414 (GNAQ)    04972 Pancreatic secretion     102287414 (GNAQ)   09155 Excretory system    04961 Endocrine and other factor-regulated calcium reabsorption     102287414 (GNAQ)   09156 Nervous system    04724 Glutamatergic synapse     102287414 (GNAQ)    04725 Cholinergic synapse     102287414 (GNAQ)    04728 Dopaminergic synapse     102287414 (GNAQ)    04726 Serotonergic synapse     102287414 (GNAQ)    04720 Long-term potentiation     102287414 (GNAQ)    04730 Long-term depression     102287414 (GNAQ)    04723 Retrograde endocannabinoid signaling     102287414 (GNAQ)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     102287414 (GNAQ)   09159 Environmental adaptation    04713 Circadian entrainment     102287414 (GNAQ)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102287414 (GNAQ)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102287414 (GNAQ)    05163 Human cytomegalovirus infection     102287414 (GNAQ)   09171 Infectious disease: bacterial    05135 Yersinia infection     102287414 (GNAQ)   09174 Infectious disease: parasitic    05146 Amoebiasis     102287414 (GNAQ)    05142 Chagas disease     102287414 (GNAQ)    05143 African trypanosomiasis     102287414 (GNAQ)   09164 Neurodegenerative disease    05010 Alzheimer disease     102287414 (GNAQ)    05016 Huntington disease     102287414 (GNAQ)    05017 Spinocerebellar ataxia     102287414 (GNAQ)    05022 Pathways of neurodegeneration - multiple diseases     102287414 (GNAQ)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     102287414 (GNAQ)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bom04147]     102287414 (GNAQ)    04031 GTP-binding proteins [BR:bom04031]     102287414 (GNAQ) Exosome [BR:bom04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102287414 (GNAQ) GTP-binding proteins [BR:bom04031]  Heterotrimeric G-proteins   Alpha Subunits    Alpha type 3 (Gq/11) [OT]     102287414 (GNAQ) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-alpha Arf Gtr1_RagA AAA_29 Motif Other DBs NCBI-GeneID:  102287414 NCBI-ProteinID:  XP_005893049 LinkDB All DBs Position Un AA seq 359 aa AA seqDB search MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagcccggcgg atcaacgacgagattgagaggcagctccgcagggacaagagggacgcccgccgggagctc aagctgctgctgctcgggacaggagagagtggcaagagtacatttatcaagcagatgaga atcatccatgggtcgggctactctgatgaagacaaaaggggcttcaccaagctggtgtat cagaacatcttcacggccatgcaggctatgatcagagccatggacacgctcaagatcccc tacaagtacgagcacaataaggctcatgcacagttagttcgagaagttgatgtggagaag gtatctgcatttgagaatccatatgtagatgcaataaagagtttatggaatgatcctgga atccaggaatgctatgacagacgacgagaatatcagttatctgactctaccaaatactat cttaatgacttggaccgcgttgccgaccctgcctacctgcctacgcaacaagatgtgctc agagttcgagtccccaccacagggatcatcgaataccccttcgacttacaaagtgtcatt ttcagaatggtcgatgtagggggccagaggtcagagagaagaaaatggatacactgcttt gaaaacgtcacctctatcatgtttctagtagcgcttagtgaatacgatcaagttctcgtg gagtcagacaatgagaaccgaatggaggaaagcaaagcactgtttagaacaattatcacg tatccctggttccagaactcctcagttattctgttcttaaacaagaaagatcttctagag gagaaaattatgtattcccacctagttgactatttcccggaatacgatggaccccagcga gatgcccaggcagctcgagaattcatcctgaagatgttcgtggacctgaacccagacagt gacaaaatcatctactcgcacttcacgtgcgccacagacaccgagaacatccgctttgtg ttcgccgctgtcaaggacaccatcctccagctgaacctgaaggagtacaatctggtctag

DBGET integrated database retrieval system