KEGG   Bipolaris oryzae: COCMIDRAFT_31681
Entry
COCMIDRAFT_31681  CDS       T03125                                 
Name
(RefSeq) hypothetical protein
  KO
K21339  4-O-dimethylallyl-L-tyrosine synthase [EC:2.5.1.122]
Organism
bor  Bipolaris oryzae
Brite
KEGG Orthology (KO) [BR:bor00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    COCMIDRAFT_31681
Enzymes [BR:bor01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.122  4-O-dimethylallyl-L-tyrosine synthase
     COCMIDRAFT_31681
SSDB
Motif
Pfam: Trp_DMAT
Other DBs
NCBI-GeneID: 19121932
NCBI-ProteinID: XP_007682368
JGI: Cocmi1_31681
UniProt: W7A4P0
LinkDB
Position
Unknown
AA seq 448 aa
MQIIRLYRRIRSLAARKPKEPKKVKQKSLGVWLSLNESLTVFDEDTRFWWEITGPILARM
MELMGYDQDTQHKHLLFYYMYILPALGRRPSSDGHPNGWESFMTDDCSPLELSWEWGMSA
GESRVRFSIEPIGKYAGNSADPLNEKMVFQLIDTLRPAFHKSLDLTIFNAFSEALTTTHK
KLDTKHISVNGRSQHFVAFDLDVGTPSLKAYFIPGLKAVETDTPVPELVVQAIDSCKPHL
GHVFMNNFRRFNSDLTNFSKTSPSRPQIEIIGIDCVVPIKSRVKIYVRHRETSFDSVCRM
LSLGASKPIDPGSLASLHELWSLVLDLPEYFPSNQELPNVPHRTSGILYYFEIKPTSYDI
VPKVYIPVRHYAKNDLSIAQGLATYFERRGQSATADKYVQALSDIFSHRSLDSGLGLHTY
ITCALKKTGLSVTSYFNPEIYHPNRYIS
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgcagattattcgtctctatcggagaattcgcagccttgctgcaaggaaacctaaggaa
ccgaagaaggtgaagcaaaagagcctgggagtatggctatctctcaatgaatcactgact
gttttcgacgaagatactcgcttctggtgggaaataaccgggcccatccttgcgcgcatg
atggaattaatggggtacgaccaggatacacagcataaacatttactgttttactacatg
tatattctaccagctcttggtagaagaccgtcctcggatggtcaccccaatgggtgggaa
agcttcatgaccgacgactgctcccctcttgaattgagttgggaatggggcatgtcagcc
ggggagtcacgcgttcgcttctccatagagccaatcggaaaatatgcgggcaactcggcc
gaccctctgaacgagaagatggtattccaacttatcgatacgctccggccagcgttccat
aagagtctggacctgaccattttcaatgcattctccgaggctctgaccacaacccacaag
aagctcgacacaaaacatatttcggtaaatgggcgttcgcagcactttgttgctttcgac
ctcgatgtcggaactccctctttgaaggcgtactttatccctggcctgaaggcggttgag
acagatacaccagttcccgaactggtggtccaagcaatcgactcatgcaagccacatctt
ggacacgtcttcatgaacaactttcgcaggttcaactccgacctgacgaacttctccaaa
actagtccaagtcgtcctcagatcgaaatcattggcatcgactgtgtcgtccccatcaag
tcacgagtcaagatctacgtccgtcaccgagaaacatctttcgacagcgtatgtcgaatg
ctttcactgggcgccagtaagcctatcgaccccggttctttagctagcttgcacgagtta
tggtctctagttcttgatctgccagaatactttccttcgaaccaagaactgccgaatgtt
ccgcaccggacctcgggtatcctctactacttcgaaatcaaacccacatcatacgacata
gttccaaaggtgtatattcctgttcggcattacgctaaaaacgatctctccattgcccag
gggctggccacgtactttgagcgtcgcggacagtcggcgacagcagataaatacgtgcaa
gcactttcggatatcttttcacatagatctcttgactctggacttggcctacatacctat
atcacatgcgcgcttaagaagacagggctatctgtgacttcatacttcaacccggagatt
taccatccaaatcggtacatctcatga

DBGET integrated database retrieval system