Bipolaris oryzae: COCMIDRAFT_92810 Help Entry COCMIDRAFT_92810  CDS       T03125                                  Name (RefSeq) hypothetical protein   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism bor  Bipolaris oryzae Pathway bor00510   N-Glycan biosynthesis bor00513   Various types of N-glycan biosynthesis bor01100   Metabolic pathways bor04141   Protein processing in endoplasmic reticulum Module bor_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:bor00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     COCMIDRAFT_92810    00513 Various types of N-glycan biosynthesis     COCMIDRAFT_92810  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     COCMIDRAFT_92810 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost4 Motif Other DBs NCBI-GeneID:  19128151 NCBI-ProteinID:  XP_007687058 JGI:  Cocmi1_92810 UniProt:  W6ZRV9 LinkDB All DBs Position Unknown AA seq 50 aa AA seqDB search MITDSQLYSLAIFLGSAAMLLIVVYHFLEVNSEDHKVEEKPRAAGGKVKA NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atgattacagactcccaactctactcgctcgcaatcttccttggaagcgctgccatgctg cttatcgtcgtctatcatttcctggaagtcaactccgaagatcacaaagttgaggagaag ccaagggctgcgggaggaaaggtcaaggcatga

DBGET integrated database retrieval system