KEGG   Heyndrickxia oleronia: I5818_17415
Entry
I5818_17415       CDS       T07202                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
bou  Heyndrickxia oleronia
Brite
KEGG Orthology (KO) [BR:bou00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bou03000]
    I5818_17415
Transcription factors [BR:bou03000]
 Prokaryotic type
  Other transcription factors
   Others
    I5818_17415
SSDB
Motif
Pfam: Bmp Peripla_BP_4
Other DBs
NCBI-ProteinID: QQZ03523
LinkDB
Position
complement(3488712..3489659)
AA seq 315 aa
MIKKLFIIIACILLLSSCSNRVDKGKLNKVGMLVPETINDQVWGTKGYKGLLNIQNDFDV
DVYYKEGIENASAIEHAVSEFKQKNVNLIFGHGFEYADTFNKIAKKYPTIHFVSFNGDAT
QKNTTSLRFEGHAMGFFGGMTAAHMSTTKKIGIIATHSWQPEIKGFVEGAKYEDPNITVL
LKYTDNWDDGQKAVGLLDKLLDEEVDVVYPAGDGFNVPVIEKIKEKGLYAIGYVSDQSDL
GKNTVLTSTIQQASKLYDIVAKKYAEGTLQSGNLSFDFQDGVIEMGKFSPRVDEKFQRKM
KRFVKKYKETGDLPK
NT seq 948 nt   +upstreamnt  +downstreamnt
atgataaaaaagttattcattatcattgcctgtatattacttttatcaagttgctcaaat
agggttgataaaggtaaacttaacaaggtaggaatgttagtacctgaaacaatcaatgat
caagtctggggaacaaaagggtataagggtctgttgaatatccaaaatgactttgatgtc
gatgtctattataaagaaggaattgaaaacgcatctgccatcgaacatgcagtcagtgaa
tttaaacaaaaaaatgtaaatttaatttttggtcatggatttgagtatgcggatacgttt
aataaaattgctaaaaaatatcctactattcatttcgttagcttcaatggggatgcaaca
caaaaaaatacaactagtttaagatttgaaggccatgcaatgggtttttttggtgggatg
acggcagcacatatgtcaaccacaaaaaaaataggtattattgcaacacatagttggcag
ccggaaattaaaggatttgttgaaggcgcaaaatatgaggatccaaatattaccgtctta
ttaaagtatactgataattgggatgatggacaaaaagctgtagggcttttggacaaatta
ttagatgaagaagtagatgtggtatacccagctggcgatggctttaatgtaccggtcatt
gaaaaaattaaagaaaaaggtctatatgcaataggctatgtttcagatcaatcggattta
gggaaaaatacagttctaacaagtacgattcaacaagcaagtaagctttatgatattgtc
gcaaaaaaatatgcagagggtactctccaatcagggaatctttcatttgacttccaagat
ggtgtaatagaaatggggaaattcagtccccgggttgacgaaaaatttcaaaggaaaatg
aaacgttttgtcaaaaaatataaagaaacaggagacttaccaaagtaa

DBGET integrated database retrieval system