Bombus pascuorum (common carder bee): 132914912 Help Entry 132914912         CDS       T09597                                  Name (RefSeq) protein max-like   KO K04453   Max protein Organism bpas  Bombus pascuorum (common carder bee) Pathway bpas03083   Polycomb repressive complex Brite KEGG Orthology (KO) [BR:bpas00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     132914912  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bpas03000]     132914912    03036 Chromosome and associated proteins [BR:bpas03036]     132914912 Transcription factors [BR:bpas03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     132914912 Chromosome and associated proteins [BR:bpas03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      132914912 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HLH FliT bHLH_INO4 ITGAX-like_Ig_3 DUF3641 SWIB Motif Other DBs NCBI-GeneID:  132914912 NCBI-ProteinID:  XP_060830405 LinkDB All DBs Position 15:1121517..1125321 Genome browser AA seq 121 aa AA seqDB search MSDDDRDIDIESDEDDYSDSRQMHSNNTQCSAQEEKRAHHNALERKRRDHIKDNFSILKD HVPTLQGEKVASRTQILKKTAEYIQFMQRKNSSHQQDIADLMRQNKLLRSQIEICKRSRQ R NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgagtgacgatgatcgagatattgacattgagagtgatgaagatgactattccgattct aggcaaatgcattcaaacaatacccaatgttctgctcaagaagaaaaacgggcacaccat aatgcactagaacggaaacgtcgggatcacatcaaagataatttctctatccttaaagac catgtacctacgttgcaaggagaaaaggttgcaagtaggacacaaatactcaagaaaact gctgagtatatacagtttatgcaacgcaagaattcctcccatcaacaggatattgctgac ttaatgcgccagaataagctcttgcggtctcaaattgagatctgtaagagaagccgtcaa cgctaa

DBGET integrated database retrieval system