KEGG   Bordetella pertussis Tohama I: BP1119
Entry
BP1119            CDS       T00139                                 
Symbol
fim2
Name
(GenBank) serotype 2 fimbrial subunit precursor
  KO
K07345  major type 1 subunit fimbrin (pilin)
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe05133  Pertussis
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    BP1119 (fim2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpe02044]
    BP1119 (fim2)
   02035 Bacterial motility proteins [BR:bpe02035]
    BP1119 (fim2)
Secretion system [BR:bpe02044]
 Chaperone-usher system
  Type 1 pilus assembly protein
   BP1119 (fim2)
Bacterial motility proteins [BR:bpe02035]
 Pilus system
  Fimbrial proteins
   BP1119 (fim2)
SSDB
Motif
Pfam: FimA Fimbrial PTPS_related
Other DBs
NCBI-ProteinID: CAE41417
UniProt: P05788
LinkDB
Position
complement(1175853..1176485)
AA seq 210 aa
MLPMQIPFQRALRLCLRAALAAIASAAHADDGTIVITGTITDTTCVIEDPSGPNHTKVVQ
LPKISKNALKANGDQAGRTPFIIKLKDCPSSLGNGVKAYFEPGPTTDYSTGDLRAYKMVY
ATNPQTQLSNITAATEAQGVQVRISNLNDSKITMGANEATQQAAGFDPEVQTGGTSRTVT
MRYLASYVKKNGDVEASAITTYVGFSVVYP
NT seq 633 nt   +upstreamnt  +downstreamnt
gtgttacccatgcaaatccctttccaacgcgccctgcgcctgtgcttgcgggccgctctg
gcggccattgcgtccgcggcgcacgccgacgacggcaccatcgtcatcaccggcaccatc
accgacaccacctgcgtcatcgaggacccctcaggcccgaatcacaccaaggtcgtacag
ctacccaaaatctccaagaacgcattgaaggccaacggcgaccaggccggccgtacccct
ttcatcatcaagctgaaggattgcccgtccagcctgggcaacggcgtcaaggcctatttc
gaaccgggcccgaccactgactacagcaccggcgacttgcgggcatacaagatggtctat
gccaccaatccgcaaacccagctgagcaacatcaccgccgcaaccgaggcccagggcgtg
caggtacggatttccaatctcaatgactccaagatcaccatgggtgcgaacgaggcgacc
cagcaggcggcaggcttcgaccccgaagtgcagaccggtgggaccagcagaaccgtcacg
atgcgctacctggcctcctacgtcaaaaagaacggcgacgtcgaagccagcgccatcacc
acttatgtgggtttttccgtggtctacccctag

KEGG   Bordetella pertussis Tohama I: BP1568
Entry
BP1568            CDS       T00139                                 
Symbol
fim3
Name
(GenBank) serotype 3 fimbrial subunit precursor
  KO
K07345  major type 1 subunit fimbrin (pilin)
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe05133  Pertussis
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    BP1568 (fim3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpe02044]
    BP1568 (fim3)
   02035 Bacterial motility proteins [BR:bpe02035]
    BP1568 (fim3)
Secretion system [BR:bpe02044]
 Chaperone-usher system
  Type 1 pilus assembly protein
   BP1568 (fim3)
Bacterial motility proteins [BR:bpe02035]
 Pilus system
  Fimbrial proteins
   BP1568 (fim3)
SSDB
Motif
Pfam: FimA Fimbrial CBM_6
Other DBs
NCBI-ProteinID: CAE41857
UniProt: P17835
LinkDB
Position
1647602..1648216
AA seq 204 aa
MSKFSYPALRAALILAASPVLPALANDGTIVITGSISDQTCVIEEPSTLNHIKVVQLPKI
SKNALRNDGDTAGATPFDIKLKECPQALGALKLYFEPGITTNYDTGDLIAYKQTYNASGN
GNLSTVSSATKAKGVEFRLANLNGQHIRMGTDKTTQAAQTFTGKVTNGSKSYTLRYLASY
VKKPKEDVDAAQITSYVGFSVVYP
NT seq 615 nt   +upstreamnt  +downstreamnt
atgtccaagttttcataccctgccttgcgcgccgcgcttatccttgccgcctcgcccgta
ctgccagcgctggccaacgacggcaccatcgtcatcaccggcagcatctccgaccagacc
tgcgtcatcgaagagcccagcaccctcaaccatatcaaggtcgtgcaactgcccaagatt
tccaagaacgcgctcaggaacgacggcgacaccgccggcgccacgcccttcgacatcaag
ctgaaggaatgcccccaggcgctgggcgcgctcaagctgtatttcgagcccggcatcacc
accaactacgacacgggcgatctgattgcctacaagcagacctacaacgcatccggcaac
ggcaacctgagcaccgtgtcgtccgccaccaaggccaagggcgtggagttccgcctggcc
aacctcaacggccagcacatccgcatgggcacggacaaaaccacgcaagccgcgcaaacc
tttaccggcaaggtcaccaatggcagcaagagctacaccctgcgctatctcgcctcgtac
gtgaagaaacccaaggaagatgtcgacgcggcccagatcaccagctacgtcggcttttcc
gtcgtctacccctga

DBGET integrated database retrieval system