KEGG   Bordetella pertussis Tohama I: BP1879
Entry
BP1879            CDS       T00139                                 
Symbol
fhaB
Name
(GenBank) filamentous hemagglutinin/adhesin
  KO
K15125  filamentous hemagglutinin
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe05133  Pertussis
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    BP1879 (fhaB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bpe00536]
    BP1879 (fhaB)
Glycosaminoglycan binding proteins [BR:bpe00536]
 Heparan sulfate / Heparin
  Microbial pathogens
   BP1879 (fhaB)
SSDB
Motif
Pfam: TPS Fil_haemagg_2 ESPR Fil_haemagg CCDC93_CC
Other DBs
NCBI-ProteinID: CAE42162
UniProt: P12255
LinkDB
Position
1968781..1979553
AA seq 3590 aa
MNTNLYRLVFSHVRGMLVPVSEHCTVGNTFCGRTRGQARSGARATSLSVAPNALAWALML
ACTGLPLVTHAQGLVPQGQTQVLQGGNKVPVVNIADPNSGGVSHNKFQQFNVANPGVVFN
NGLTDGVSRIGGALTKNPNLTRQASAILAEVTDTSPSRLAGTLEVYGKGADLIIANPNGI
SVNGLSTLNASNLTLTTGRPSVNGGRIGLDVQQGTVTIERGGVNATGLGYFDVVARLVKL
QGAVSSKQGKPLADIAVVAGANRYDHATRRATPIAAGARGAAAGAYAIDGTAAGAMYGKH
ITLVSSDSGLGVRQLGSLSSPSAITVSSQGEIALGDATVQRGPLSLKGAGVVSAGKLASG
GGAVNVAGGGAVKIASASSVGNLAVQGGGKVQATLLNAGGTLLVSGRQAVQLGAASSRQA
LSVNAGGALKADKLSATRRVDVDGKQAVALGSASSNALSVRAGGALKAGKLSATGRLDVD
GKQAVTLGSVASDGALSVSAGGNLRAKQLVSSAQLEVRGQREVALDDASSARGMTVVAAG
ALAARNLQSKGAIGVQGGEAVSVANANSDAELRVRGRGQVDLHDLSAARGADISGEGRVN
IGRARSDSDVKVSAHGALSIDSMTALGAIGVQAGGSVSAKDMRSRGAVTVSGGGAVNLGD
VQSDGQVRATSAGAMTVRDVAAAADLALQAGDALQAGFLKSAGAMTVNGRDAVRLDGAHA
GGQLRVSSDGQAALGSLAAKGELTVSAARAATVAELKSLDNISVTGGERVSVQSVNSASR
VAISAHGALDVGKVSAKSGIGLEGWGAVGADSLGSDGAISVSGRDAVRVDQARSLADISL
GAEGGATLGAVEAAGSIDVRGGSTVAANSLHANRDVRVSGKDAVRVTAATSGGGLHVSSG
RQLDLGAVQARGALALDGGAGVALQSAKASGTLHVQGGEHLDLGTLAAVGAVDVNGTGDV
RVAKLVSDAGADLQAGRSMTLGIVDTTGDLQARAQQKLELGSVKSDGGLQAAAGGALSLA
AAEVAGALELSGQGVTVDRASASRARIDSTGSVGIGALKAGAVEAASPRRARRALRQDFF
TPGSVVVRAQGNVTVGRGDPHQGVLAQGDIIMDAKGGTLLLRNDALTENGTVTISADSAV
LEHSTIESKISQSVLAAKGDKGKPAVSVKVAKKLFLNGTLRAVNDNNETMSGRQIDVVDG
RPQITDAVTGEARKDESVVSDAALVADGGPIVVEAGELVSHAGGIGNGRNKENGASVTVR
TTGNLVNKGYISAGKQGVLEVGGALTNEFLVGSDGTQRIEAQRIENRGTFQSQAPAGTAG
ALVVKAAEAIVHDGVMATKGEMQIAGKGGGSPTVTAGAKATTSANKLSVDVASWDNAGSL
DIKKGGAQVTVAGRYAEHGEVSIQGDYTVSADAIALAAQVTQRGGAANLTSRHDTRFSNK
IRLMGPLQVNAGGAVSNTGNLKVREGVTVTAASFDNETGAEVMAKSATLTTSGAARNAGK
MQVKEAATIVAASVSNPGTFTAGKDITVTSRGGFDNEGKMESNKDIVIKTEQFSNGRVLD
AKHDLTVTASGQADNRGSLKAGHDFTVQAQRIDNSGTMAAGHDATLKAPHLRNTGQVVAG
HDIHIINSAKLENTGRVDARNDIALDVADFTNTGSLYAEHDATLTLAQGTQRDLVVDQDH
ILPVAEGTLRVKAKSLTTEIETGNPGSLIAEVQENIDNKQAIVVGKDLTLSSAHGNVANE
ANALLWAAGELTVKAQNITNKRAALIEAGGNARLTAAVALLNKLGRIRAGEDMHLDAPRI
ENTAKLSGEVQRKGVQDVGGGEHGRWSGIGYVNYWLRAGNGKKAGTIAAPWYGGDLTAEQ
SLIEVGKDLYLNAGARKDEHRHLLNEGVIQAGGHGHIGGDVDNRSVVRTVSAMEYFKTPL
PVSLTALDNRAGLSPATWNFQSTYELLDYLLDQNRYEYIWGLYPTYTEWSVNTLKNLDLG
YQAKPAPTAPPMPKAPELDLRGHTLESAEGRKIFGEYKKLQGEYEKAKMAVQAVEAYGEA
TRRVHDQLGQRYGKALGGMDAETKEVDGIIQEFAADLRTVYAKQADQATIDAETDKVAQR
YKSQIDAVRLQAIQPGRVTLAKALSAALGADWRALGHSQLMQRWKDFKAGKRGAEIAFYP
KEQTVLAAGAGLTLSNGAIHNGENAAQNRGRPEGLKIGAHSATSVSGSFDALRDVGLEKR
LDIDDALAAVLVNPHIFTRIGAAQTSLADGAAGPALARQARQAPETDGMVDARGLGSADA
LASLASLDAAQGLEVSGRRNAQVADAGLAGPSAVAAPAVGAADVGVEPVTGDQVDQPVVA
VGLEQPVATVRVAPPAVALPRPLFETRIKFIDQSKFYGSRYFFEQIGYKPDRAARVAGDN
YFDTTLVREQVRRALGGYESRLPVRGVALVAKLMDSAGTVGKALGLKVGVAPTAQQLKQA
DRDFVWYVDTVIDGQKVLAPRLYLTEATRQGITDQYAGGGALIASGGDVTVNTDGHDVSS
VNGLIQGRSVKVDAGKGKVVVADSKGAGGGIEADDEVDVSGRDIGIEGGKLRGKDVRLKA
DTVKVATSMRYDDKGRLAARGDGALDAQGGQLHIEAKRLETAGATLKGGKVKLDVDDVKL
GGVYEAGSSYENKSSTPLGSLFAILSSTTETNQSAHANHYGTRIEAGTLEGKMQNLEIEG
GSVDAAHTDLSVARDARFKAAADFAHAEHEKDVRQLSLGAKVGAGGYEAGFSLGSESGLE
AHAGRGMTAGAEVKVGYRASHEQSSETEKSYRNANLNFGGGSVEAGNVLDIGGADINRNR
YGGAAKGNAGTEEALRMRAKKVESTKYVSEQTSQSSGWSVEVASTASARSSLLTAATRLG
DSVAQNVEDGREIRGELMAAQVAAEATQLVTADTAAVALSAGISADFDSSHSRSTSQNTQ
YLGGNLSIEATEGDATLVGAKFGGGDQVSLKAAKSVNLMAAESTFESYSESHNFHASADA
NLGANAVQGAVGLGLTAGMGTSHQITNETGKTYAGTSVDAANVSIDAGKDLNLSGSRVRG
KHVVLDVEGDINATSKQDERNYNSSGGGWDASAGVAIQNRTLVAPVGSAGFNFNTEHDNS
RLTNDGAAGVVASDGLTGHVKGDANLTGATIADLSGKGNLKVDGAVNAQNLKDYRDKDGG
SGGLNVGISSTTLAPTVGVAFGRVAGEDYQAEQRATIDVGQTKDPARLQVGGGVKGTLNQ
DAAQATVVQRNKHWAGGGSEFSVAGKSLKKKNQVRPVETPTPDVVDGPPSRPTTPPASPQ
PIRATVEVSSPPPVSVATVEVVPRPKVETAQPLPPRPVAAQVVPVTPPKVEVAKVEVVPR
PKVETAQPLPPRPVVAEKVTTPAVQPQLAKVETVQPVKPETTKPLPKPLPVAKVTKAPPP
VVETAQPLPPVKPQKATPGPVAEVGKATVTTVQVQSAPPKPAPVAKQPAPAPKPKPKPKP
KAERPKPGKTTPLSGRHVVQQQVQVLQRQASDINNTKSLPGGKLPKPVTVKLTDENGKPQ
TYTINRREDLMKLNGKVLSTKTTLGLEQTFRLRVEDIGGKNYRVFYETNK
NT seq 10773 nt   +upstreamnt  +downstreamnt
atgaacacgaacctgtacaggctggtcttcagccatgttcgcggcatgcttgttcccgtg
agcgagcattgcaccgtcggaaacaccttctgtgggcgcacgcgtggtcaagcgcgaagt
ggggcccgcgccacgagcctgtccgtagcgcccaatgcgctggcctgggccctgatgttg
gcgtgtacgggtcttccgttagtaacgcacgcccagggcttggttcctcaggggcagaca
caggtgctgcagggcgggaacaaggttcccgttgtcaatatcgccgacccaaattccggc
ggcgtctcgcacaacaagttccagcagttcaacgtcgccaaccctggcgtggtcttcaac
aacggcctgaccgacggcgtgtccaggatcggcggggcgctgaccaagaaccccaacctg
actcgccaggcctcggccattcttgccgaagtcacggacacttcgcccagtcgcctggcc
ggtacgctcgaagtctatggcaagggcgccgacctcatcatcgccaaccccaacggcatc
agcgtcaacggcctgagcacgctcaacgccagcaacctgacgctcacgacggggcgtccc
agcgtcaacggcggccgcatcggccttgatgtccaacagggcaccgtcacgatcgaacga
ggcggcgtcaatgccaccggcctgggctatttcgacgtggtggcgcgcctggtcaagctg
cagggtgccgtgtcgagcaagcagggcaagcccctggccgacatcgcggtggtcgccggc
gccaaccggtacgaccacgcaacccgccgcgccacgccgatcgccgcaggcgcgcgcggc
gccgccgcgggcgcctacgcgattgacggcacggcggcgggcgccatgtacggcaagcac
atcacgctggtgtccagcgattcaggcctgggcgtgcgccagctcggcagcctgtcctcg
ccatcggccatcaccgtgtcgtcgcagggcgaaatcgcgctgggcgacgccacggtccag
cgcggcccgctcagcctcaagggcgcgggggtcgtgtcggccggcaaactggcctccggg
gggggggcggtgaacgtcgcgggcggcggggcggtgaagatcgcgtcggccagcagcgtt
ggaaacctcgcggtgcaaggcggcggcaaggtacaggccacgctgttgaatgccgggggg
acgttgctggtgtcgggccgccaggccgtccagcttggcgcggcgagcagccgtcaggcg
ctgtccgtgaacgcgggcggcgccctcaaggcggacaagctgtcggcgacgcgacgggtc
gacgtggatggcaagcaggccgtcgcgctggggtcggccagcagcaatgcgctgtcggtg
cgtgccggcggcgccctcaaggcgggcaagctgtcggcgacggggcgactggacgtggac
ggcaagcaggccgtcacgctgggttcggttgcgagcgacggtgcgctgtcggtaagcgct
ggcggaaacctgcgggcgaagcaattggtctccagtgcccaacttgaggtgcgtgggcag
cgggaggtcgcgctggatgacgcttcgagcgcacgcggcatgaccgtggttgccgcagga
gcgctggcggcccgcaacctgcagtccaagggcgccatcggcgtacagggtggagaggcg
gtcagcgtggccaacgcgaacagcgacgcggaattgcgcgtgcgcgggcgcggccaggtg
gatctgcacgacctgagcgcagcgcgcggcgcggatatctccggcgaggggcgcgtcaat
atcggccgtgcgcgcagcgatagcgatgtgaaggtctccgcgcacggcgccttgtcgatc
gatagcatgacggccctcggtgcgatcggcgtccaggcaggcggcagcgtgtcggccaag
gatatgcgcagccgtggcgccgtcaccgtcagcggcggcggcgccgtcaacctgggcgat
gtccagtcggatgggcaggtccgcgccaccagcgcgggcgccatgacggtgcgagacgtc
gcggctgccgccgaccttgcgctgcaggcgggcgacgcgttgcaggccgggttcctgaaa
tcggccggtgccatgaccgtgaacggccgcgatgccgtgcgactggatggcgcgcacgcg
ggcgggcaattgcgggtttccagcgacgggcaggctgcgttgggcagtctcgcggccaag
ggcgagctgacggtatcggccgcgcgcgcggcgaccgtggccgagttgaagtcgctggac
aacatctccgtgacgggcggcgaacgcgtgtcggttcagagcgtcaacagcgcgtccagg
gtcgccatttcggcgcacggcgcgctggatgtaggcaaggtttccgccaagagcggtatc
gggctcgaaggctggggcgcggtcggagcggactccctcggttccgacggcgcgatcagc
gtgtccgggcgcgatgcggtcagggtcgatcaagcccgcagtcttgccgacatttcgctg
ggggcggaaggcggcgccacgctgggcgcggtggaggccgccggttcgatcgacgtgcgc
ggcggatccacggtggcggcgaactcgctgcacgccaatcgcgacgttcgggtcagcggc
aaggatgcggtgcgcgtaacggccgccaccagcgggggcggtctgcatgtgtcgagcggc
cgccagctcgatctgggcgccgtgcaggcgcgcggcgcgctggccctggacggaggcgcc
ggcgtggcgctgcaatcggccaaggctagcggcacgctgcatgtgcagggcggcgagcac
ctggacctgggcacgttggccgccgtaggggcggtggacgtcaatggcacgggagacgtg
cgcgttgcgaagctggtgagcgatgcaggcgccgatctgcaagcggggcgctccatgacg
ctgggtatcgtcgacacgaccggcgatctgcaggcgcgcgcgcagcagaagctggagctc
gggtcggttaagagcgatggcggccttcaggccgccgccggcggggccctcagcctggcg
gcggcggaagtcgcaggggcgctggagctctcgggccagggcgtcaccgtggacagagcc
agcgctagccgggcacgcatcgacagcaccggttcggtcggcatcggcgcgctgaaggca
ggcgctgtcgaggccgcctcgccacggcgggcgcgccgcgcgctgcggcaggatttcttc
acgcccggcagcgtggtggtccgcgcccagggcaatgtcacggtcgggcgcggcgatccg
catcagggcgtgctggcccagggcgacatcatcatggatgcgaagggcggcaccttgctg
ttgcgcaacgatgccttgaccgagaacgggacggtcaccatatcggccgattcggccgtg
ctcgagcattccaccatcgagagcaagatcagccagagcgtgctggctgccaaaggggac
aagggcaagccggcggtgtcggtgaaggtcgcgaagaagctgtttctcaatggtacgttg
cgggccgtcaacgacaacaacgaaaccatgtccgggcgccagatcgacgtcgtggacgga
cgtccgcagatcaccgacgcggtcacgggcgaagcgcgtaaggacgaatcggttgtgtcc
gacgccgcgctcgtggccgatggcggtccgatcgtggtcgaggccggcgagctggtcagc
catgccggcggtatcggcaacggccgcaacaaggagaatggcgccagcgtcaccgtgcgc
acgactggcaacctggtcaacaagggctacatctcggccggcaagcagggcgtgctcgag
gtgggcggcgccttgacgaacgagttcctggtcggctcggacggcacccagcgcatcgag
gcgcagcgcatcgagaacaggggcaccttccagagccaggctccggcgggcacggccggc
gccctggtggtcaaggctgccgaggccatcgtgcacgacggcgtcatggccaccaaaggc
gagatgcagatcgccggcaagggcggcgggtctccgaccgtcaccgccggcgcaaaggcg
acgaccagcgcgaacaagctgagcgtcgacgtggcaagctgggacaacgcgggaagcctg
gatatcaagaagggcggcgcgcaggtcacggtggccgggcgctatgccgagcacggcgag
gtttcgatacagggcgattacaccgtctcggccgacgccatcgcgctggcggcgcaggtc
acccagcgcggaggcgccgcgaacctgacctcgcggcacgacacccgtttctccaacaag
attcgcctgatggggccgttgcaggtcaacgccggcggcgcggtgtccaataccggcaat
ctgaaagtgcgcgagggcgtgaccgtaacggcggcgtcgttcgacaacgagaccggggcc
gaggtcatggccaagagcgccacgctgacgacttccggggccgcgcgcaacgcgggcaag
atgcaggtcaaggaggccgccacgatcgttgccgccagcgtttccaatcccggcacgttc
acggccggcaaggatatcactgttacctcgcgcggaggattcgataacgaaggcaagatg
gagtccaacaaggacatcgtcatcaagacggaacagttcagcaatggcagggttctcgac
gccaagcatgatctgacggtcacggcgagcgggcaggcggacaaccggggcagcctgaag
gcaggccacgatttcacggtgcaggcccagcgtatcgacaatagcggaaccatggccgcc
ggccacgacgccacgctgaaggcgccgcacctgcgcaatacgggccaggtcgtagccggg
cacgacatccatatcatcaacagcgccaagctggagaacaccgggcgcgtggatgcgcgc
aacgacatcgctctggatgtggcggatttcaccaacacgggatccctctacgccgagcat
gacgcgacgctgacgcttgcgcaaggcacgcagcgcgatctggtggtggaccaggatcat
atcctgccggtggcggaggggacgttacgcgtcaaggccaagtcgctgaccaccgaaatc
gagaccggcaatcccggcagcctgatcgccgaggtgcaggaaaatatcgacaacaagcag
gccatcgtcgtcggcaaggacctgacgctgagttcggcgcacggcaacgtggccaacgaa
gcgaacgcgctgctgtgggccgccggggagctgaccgtcaaggcgcagaacatcaccaat
aaacgggccgcgctgatcgaggcgggcggcaacgcccggctgacggcggccgttgccttg
ctcaacaagctgggccgcattcgcgcgggcgaggacatgcacctggatgcgccgcgcatc
gagaacaccgcgaaactgagcggcgaggtgcaacgcaaaggcgtgcaggacgtcggggga
ggcgagcacggccgctggagcggtatcggctatgtcaactactggttgcgcgccggcaat
gggaagaaggcgggaaccatcgccgcgccgtggtatggcggtgatctgacggcggagcag
tcgctcatcgaggtcggcaaggatctctatctgaatgccggagcgcgcaaggacgaacat
cgccatctgctcaatgaaggcgtgatccaggcgggcggccatggccacatcggcggcgac
gtggacaaccggtcggtggtgcgcaccgtgtccgccatggagtatttcaagacgcctctt
ccggtgagcctgactgccctggacaatcgtgccggcttgtctccggcgacctggaacttc
cagtccacgtatgaactcctggattatctgctggaccagaatcgctacgagtacatttgg
gggctgtatccgacctacaccgaatggtcggtgaatacgctgaagaacctcgacctgggc
taccaggccaagccggctcccactgcgccgccgatgcccaaggctcccgaactcgacctg
cgtggccatacgctggagtcggccgaaggccggaagatctttggcgagtacaagaagctg
caaggcgagtacgagaaggcgaagatggccgtccaggccgtggaggcttacggcgaggct
actcggcgcgtccatgatcagctgggccaacgttatggtaaggccctgggcggcatggat
gccgagaccaaggaggtcgacggcatcatccaggagttcgccgcggatctgcgaacggtc
tatgcgaagcaggccgaccaggcgaccatcgacgcagagacggacaaggtcgcccagcgc
tacaagtcgcagatcgacgcggtgcggctgcaggcgatccagcctggccgggtcacgctg
gccaaggcgctgtcggcggcgctgggcgccgactggcgcgcgctgggtcactcccaattg
atgcagcgctggaaggatttcaaggcgggcaagcgcggcgcggaaatcgcgttctatccc
aaggaacaaaccgtgctggccgccggcgccggtttgaccctgtccaacggggcgatccac
aacggcgagaacgccgcgcagaatcgcggccggccggaaggcctgaaaatcggcgcacat
tcggcgacttcggtgagcggctcgttcgacgccttgcgcgacgtggggctggaaaagcgg
ctggatatcgacgatgcgctggctgccgtgctcgtgaatccgcatattttcacgcggatc
ggggcggctcagacatcccttgccgacggcgccgccgggccggcgctggcgcgccaggcc
aggcaagcgccggagaccgacggcatggtggatgcgcgagggctgggcagcgccgatgcg
ctcgcttccctggccagcttggacgcggcgcaagggctggaggtatccggcaggcgcaat
gcgcaggtggccgacgccgggctcgccgggccgagcgccgtcgcggcgccggccgtcggg
gcggccgatgtcggcgtggagcctgtcacgggggaccaggtcgaccagcctgtcgtggcg
gtcgggctcgagcagcctgtcgcgacggtccgggtcgcgccgccagccgtcgcgttgccg
cggccgctgttcgaaacccgcatcaagtttatcgaccagagcaaattctacggctcgcgt
tatttcttcgagcagatcggctacaagcccgatcgcgccgcgcgggtggcgggcgacaac
tatttcgataccacgctggtgcgcgagcaggtgcggcgcgccctgggcggctatgaaagc
cgcctgcccgtgcgcggtgtcgcgttggtggccaagctgatggattcggccgggacggtc
ggcaaggcgctgggcctgaaggtgggtgtcgcgccgaccgcgcagcagctcaagcaggcc
gaccgcgatttcgtctggtacgtggataccgtgatcgacggccagaaggttctcgctccc
cggctgtacctgaccgaggcgacgcgccagggcatcacggatcagtacgccggcggcggg
gcgctgattgcctccggcggcgacgtaactgtcaatacggacggccatgacgtcagttcg
gtcaacgggctgatccagggcaggagcgtcaaggtggacgcgggcaagggcaaggtcgtg
gtggccgacagcaagggggcgggcggcggcatcgaggccgatgacgaggtcgacgtctca
ggccgggatatcggcatcgagggcggcaagctgcgcggcaaggatgtcaggctcaaggcc
gacacggtcaaggtcgcgacctcgatgcgttacgacgacaagggcaggctggcggcgcgc
ggcgacggcgccctggatgcgcaaggcggccagctgcatatcgaggccaagcgcctggag
acggccggcgcgacgctcaagggcggcaaggtgaagctggatgtcgatgacgtcaagttg
ggcggcgtgtacgaggcggggtccagctacgagaacaagagctcgacgccgctgggcagc
ctgttcgccatcctgtcgtcgacgacggaaaccaaccagtcggcacacgcgaaccattac
ggtacgcgcatcgaagccggtacgctggaaggaaagatgcagaacctggagatcgaaggc
ggttcggtcgatgccgcgcatacggacctgtccgtggcccgcgacgcgaggttcaaggcc
gccgcggatttcgcgcacgccgagcatgagaaggatgtgcgccaactgtccctgggtgcc
aaggtgggggcgggcggctacgaggcgggcttcagcctgggcagcgaaagcggtctggaa
gcgcacgccggccgcggtatgaccgcgggcgctgaagtcaaggtaggttatcgggcatcg
cacgaacagtcctcggaaaccgaaaagtcctatcgcaacgcgaacctcaatttcggtgga
ggctccgtcgaggctggcaatgtcctggatatcggcggcgccgacatcaaccggaaccgg
tacggcggcgccgcgaaggggaacgccgggaccgaggaggccttgcgcatgcgcgccaag
aaggtcgagtccaccaagtacgtcagcgagcagacgagccagagctccggctggagcgtg
gaggtggcatcgacggccagtgcccgttccagcctgctgacggccgccacgcgcctgggc
gacagcgtggcgcagaatgtcgaggacggccgcgagatccgcggcgagctgatggctgcg
caagtcgccgcggaggccacgcaactggtaaccgccgacacggcggcggtggcactgagt
gccggaatcagcgccgacttcgacagcagccacagccgctccacctcgcagaatacccaa
tatctgggcggaaacttgtccatcgaggccaccgagggcgatgcgacgctggtgggcgcg
aagttcggcggtggcgaccaggtcagcttgaaggcagcgaagagcgtgaacctcatggcg
gccgaatcgaccttcgaatcgtactcggagagccacaacttccacgcctccgccgacgcg
aaccttggcgccaacgccgtgcagggcgccgttggcctggggttgactgcgggtatgggg
acgtcgcatcagattaccaacgaaaccggcaagacctatgccggaacctcggtggatgcg
gcgaacgtgtcgatcgatgcaggcaaggatctgaacctttccgggtcccgcgtgcggggt
aagcatgttgtcctggatgtcgagggcgatatcaatgcgaccagcaagcaggatgaacgc
aactacaactccagcggtggcggttgggacgcctcggcaggggtggcgattcagaaccgc
acgttggttgcgcccgtggggtctgccggcttcaatttcaatacggaacacgacaattcg
cgcctgaccaatgacggggcggcgggtgtcgttgccagcgacgggttgacgggccatgtg
aaaggcgacgccaacctgaccggcgcgaccattgccgatttgtcgggcaagggcaatctc
aaggtcgacggcgcggtcaacgcgcagaacctgaaagactaccgcgacaaggacggcggc
agcggcggcctgaacgtgggcatctcgtcgaccacgctggcgcccaccgtgggcgtggcg
ttcggcagggtggccggagaggattatcaggccgagcagcgcgccacgattgacgtcggt
caaaccaaggatcccgcgcgcctgcaggtcggcggcggcgtcaagggtaccctcaatcag
gacgccgcgcaggccacggtcgttcagcgcaacaagcactgggccggaggcgggtcggaa
ttctcggtggctggcaagtcactgaagaagaagaaccaggtccgcccggtggagacgccg
acgccggatgtcgtggatggaccgcctagccgtcccaccacgccgcccgcgtcgccgcag
ccgatccgcgcgacggtcgaggtcagttcgccgccgccggtgtccgtggccacggtcgaa
gtcgtgccgcggccgaaggtcgaaacggctcagccgcttccgcctcggccggtggcggcc
caggtcgtgccggtgacgcctcccaaggtggaggtcgccaaggtggaagtcgtgccgcgg
ccgaaggttgaaacggctcagccgcttccgccccggccggtggtggccgagaaggtgacg
acgccggcggtccagccccagcttgccaaggtggagacggtgcagccggtgaagcccgaa
accaccaagccgttgcccaagccgctgccggtggcgaaggtgacgaaagcgccgccgccg
gttgtggagaccgcccagccgctgccgccggtcaagccacagaaggcgacccccggcccc
gtggctgaggtgggcaaggctacggtcacgacggtgcaggtgcagagtgcgccgcccaag
ccggccccggtggccaagcagcccgcgcctgcaccgaagcccaagcccaagcccaagccc
aaggccgagcgtccgaagccgggcaaaacgacgcccttgagcgggcgccacgtggtgcaa
cagcaggtgcaggtcttgcagcggcaagcgagtgacatcaacaacaccaagagcctgcct
ggcgggaagctgcccaagccggtcaccgtgaagctgaccgacgagaacggcaagccgcag
acgtatacgatcaaccggcgcgaggatctgatgaagctcaacggcaaggtgctgtccacc
aagacgacactgggcctggagcagaccttccgcctgcgggtcgaggatatcggcggcaag
aactaccgggtcttctatgaaaccaacaaatag

KEGG   Bordetella pertussis Tohama I: BP2667
Entry
BP2667            CDS       T00139                                 
Symbol
fhaS
Name
(GenBank) adhesin
  KO
K15125  filamentous hemagglutinin
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe05133  Pertussis
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    BP2667 (fhaS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bpe00536]
    BP2667 (fhaS)
Glycosaminoglycan binding proteins [BR:bpe00536]
 Heparan sulfate / Heparin
  Microbial pathogens
   BP2667 (fhaS)
SSDB
Motif
Pfam: TPS Fil_haemagg_2 DUF748 ESPR
Other DBs
NCBI-ProteinID: CAE42943
UniProt: Q7VVJ2
LinkDB
Position
complement(2822059..2829720)
AA seq 2553 aa
MNAFSFRLVYSECRAMYVPVAPRRRAARRGRGGAGRRLRRALAAAGAALACGAMAAPHRS
PSGVPVIDIVAPDANGLSHNRLREFDVGPPGLVFNNSLTEGRSQLAGYLNRNPGLRQAAT
AILTEITGTRPSRLHGALEVFGRRADLIVANPNGLSVDGLVTLNAGRLTLSTGRPVTEGG
RLRLDVDAGHIAVAGAGVNTSGLDYFDLVARTVSLDGPVAAGAGARAAALAVVAGRNRFE
PANGSVTPLAGSAGSGGSGYAIDGTAAGAMYGARITLLSSDSGVGVRQRGAVSSPGAITV
SSRGEIRLREATAGAGHLAVDAGGAVAATALASGGAMRIAGEGAVQVGTATSGDALSLHA
GGALQAQRLRADGPLDARAQGALRVGAADSLAGISIDTARRAELGTLQSRGALSVRAGGE
VALEAAKTDGALRVDGAGVTLGTGSAGQARIDSSAFVHVGALAAVGAQAHGGGVEIHARD
DVRVGEGRRGQGVAVRGDITIDATNGVLLLRNDVTADQGMVAASARAAVLEHASLRSGIT
PRARQARPDGGRPSVALRVQDVLFLNGTLRALDEAGAVVPGRHIEVVDGWVRIADEIAET
VHDEESVVSDAVIAARSGAVLVEAGTFVNFGGGVGNGGKQGAGSDLTLRVRGDARNKGYI
SAGRRGELQVGAVLKNEFLIDSAGTQRIEAGRIENLGTIQSLGGEAGAQGLVIKAAESVA
QAGVVAAERGVEISGRTEQRPVVAASARSSIAGERLLVQVASWDNRGSLALGQGGMRAEI
AGRYAERGTASLDGEYAVSAQTIGIAGALRQGRGATALVARQEMTLAGRLGLAGPVRLDA
GGALSNTGMASACDRLAVTAASFDNAAGGLLSAGSVDIAVRGAARNAGRLLSNQDIVLGA
ASFYNAAQAEARGNFAATVGAALENRGSLKAGGDLTLRAARIDNHGVAAAGHDVGLRSPQ
LRNSGQVAAGHDIRIVEGRELRNPGRLDARNDIELAVDDYANTGSIHADGNATLALARGT
DRDLVIDTPDILPVALGALRVKARSLRVNTEIGVPGSLDVQTQGDIDNRQAIVAGGNLKL
ASASGALNNAAGALLWAGADMALRARRITNGKAALIESGGGMRLAARDTLINDLGSVRAG
GDLRLDAARIENRATLTGHVRHAGENTVGGGGYGFWRGLAYLDYRLRYGNGAAVAAPFYD
VALQAGQSRIESGGDLYVNRELGPGRRGHLRNEGTIQAVGHAYIDGDVENRSLSREVSLA
DYLRTPLAAAIELKVTDSRAALTPAYWSFRTLYELLDYLVGENRWETIWGFYDTYTDWAT
NTLKNLDLGYVSPPPPQAPPVPAKPELSLPDGSADSPAARQALADYREALREYEAARAQA
RAAEAYGEAQRQVREILAARYGADRLAGLDTETAALDRVIGDYAAALARLGDDEPARAQA
LRKQYEQAVDRIQLAPATPGRALLARALSAALGADWRAQPHPVLVQRWNDFKAGRRGAPL
TFYPQAQTVLAAGKGVTLSDGYLRNGENAARNRGRPDTLRIGEHKVETSGGSFDALRGLG
LETRLDIDGALEAVLANRHLFARVGDQPAASSVAVPAAMPAPQGDADPAALRDVPRKPVA
PAVALPQPLIETRIKYLDQGGFYGSGYFFEQIGYQPDRATRVAGDNYFDTTLVREQVRRA
LGGYESRLPVRGDALVARLMESAGTVGKALGLKVGVAPTAQQLKLADRDFVWYVDTVIDG
QKVLAPRLYLTEATRQGITDQYAGGGALIASGGDVTVNTDGHDVSSVNGLIQGRSVKVDA
GKGKVVVADSKGAGGGIEADDEVDVSGRDIGIEGGKLRGKDVRLKADTVKVATSMRYDGK
GRLAARGDGALDAQGGQLHIEAKRLETAGATLKGGKVKLDVDDVKLGGVYEAASSYENRS
STPLGSLFAILSSTTETSQSARANHYGTRIEAGTLEGKMQNLEIEGGSVDAAHTNLSVAR
DARFKAAADFAHAEHEKEVRQLFLGGKVGAGGYEAGFSLGSESGVSSHAGRGAASSASAR
VGWESVWEKSASSRKTYRNADLRLGDGLLAVGGVLDFGGADINRDRYGGGAEGEPGLRLR
GGEVRTTKYVDTEHTVRSGGRVGLELGVDGSVNPQVTSSRLGRSLTQAGDGRGIDGGLMF
GQALSTAFQSVMADTISSTLSASLRTEWWNESRNATSENLTHVGGNARIESGAGDMALAG
VRFDGGREVDLRSAGALRMRSAESREQRTRDAHSLSLDARLAMGANLVKGDAYVRGTAGL
SGHHEHAASERHTHGRTGVRAANVHLQAARDLVMQGARVQAAQGARVEVGGALSMASVQD
VHDESHTSADWMAAAGAHASTGNGFKPQPVAQVGVSFSHGHDRGAIVAQRTGIAAGGPLS
VRVAGDAQLIGADLVSTAGQGRVQVGGRVRAEQLADRRDRDGGSAGVSAPALLSTSTRPT
LVVSGGRLERDHYDAVHRSVIAVSPGGLAAADGVSGHLQRDPVTGLRVLRDEHWAGGDMA
FTLGSVPKFDRGKYAPPRPDTSAPGGSPFSLHR
NT seq 7662 nt   +upstreamnt  +downstreamnt
atgaacgcgtttagctttcgattggtttatagcgaatgtcgcgccatgtatgtgccggtg
gcgccccggcgccgcgccgcgcggcgcgggcgtggcggggccggccggcggctgcggcgc
gcgctggccgcggcgggagccgccctggcgtgcggcgcgatggctgcgccgcatcgctcg
ccatccggcgtgccggtcatcgatatcgtcgccccggacgctaacggcctgtcgcacaac
cggctgcgcgaattcgacgtcgggccgccgggcctggtgttcaacaacagcctgaccgag
ggccgctcgcagttggccggctacctcaatcgcaaccctggcctgcgccaggcggcgacg
gccatcctgaccgagatcacggggacgcgtcccagccgcctgcacggcgcgctggaggtg
ttcggccggcgcgcggacctgatcgtcgccaatccgaacggcctcagcgtcgacggactg
gtcacgctcaacgccggccggctgacgctcagcacgggccggcccgtgacggaaggcggc
cggctcaggctggacgtggatgcgggccatatcgcggtcgcgggcgcgggcgtgaacacc
agcgggctggattacttcgatctggtggcgcgtaccgtcagcctggatggcccggtcgcc
gcaggcgccggcgcgcgggccgcggcgcttgccgtggtggccggacgcaaccggttcgag
ccggccaacggcagcgtgacgccgctggccggctcggccggcagcggcggttccggttat
gccatcgatggcacggcggcgggggcgatgtacggcgcgcgcatcacgctgttgtcgagc
gactcgggcgtgggcgtgcgccagcgtggcgcggtgtcctcgcccggggcgattacggtg
tcgtcgcgcggcgagatacgcctgcgcgaggcaacggcgggcgcagggcacctggccgtc
gatgcagggggggcggtggcggcgaccgcgctggcttcgggcggcgccatgcgcattgcg
ggggaaggcgccgtacaggtgggcacggccaccagtggcgacgccttgtcgctgcatgcc
ggcggcgccttgcaggcgcagcgcctgcgggcagacgggccgctcgatgcgcgagcgcaa
ggggccttgcgcgtgggcgcggcagacagtcttgccggcatctcgatcgatacggcgcgc
cgggccgaactgggtaccttgcaaagccgcggcgcactctcggtgcgggcaggcggggag
gtggcgctggaagccgccaagacggacggcgcgctgcgcgtcgatggcgcgggcgtgacg
ctgggcacgggcagcgcgggccaggcgcgcatcgacagcagcgcgttcgtgcatgtcggc
gcgctggccgccgtcggggcgcaggcgcacggcggcggcgtcgagatccacgcgcgcgac
gacgtgcgcgtgggcgagggccgccggggccagggcgtggccgtgcgaggagacatcacc
atcgacgcgaccaatggcgtgctgttgttgcgcaatgacgtcacggcggaccagggcatg
gtcgcggcaagcgcgcgtgccgccgtgctcgaacacgcgagcctgcgcagcgggatcacg
ccgcgggcgcggcaagcccggccggacgggggccggccatccgtcgcgctgcgggtccag
gacgtgctgtttctcaatggcacgctgcgcgcgctggacgaggcgggcgcggtggtgcct
ggacggcatatcgaagtcgtcgacggatgggtgcggatcgccgacgaaatcgccgaaacc
gtgcacgacgaagagtcggtggtttccgacgcggtcatcgcggccaggagcggcgcggta
ctggtcgaagccggcacgttcgtcaatttcggcggcggcgtgggcaacggcggcaagcag
ggggcaggcagcgacctgacgctcagggtgcgcggcgacgcgcggaacaaggggtatatc
tcggccggccggcgcggcgaactccaggtcggcgcggtcctgaaaaacgagttcctgatc
gattcggccggcacgcagcgtatcgaggccggccggatagaaaacctcggcaccatccaa
agcctgggcggcgaggccggcgcgcaggggctggtgatcaaggcggcggagtcggtcgcg
caggcgggcgtcgtggccgccgagcggggcgtggaaatttccggacggacggaacagcgg
ccggtggtggccgccagcgcgcgttcgtccatcgccggcgaacgcctcctcgtgcaggta
gccagttgggacaaccggggcagcctggcgctggggcagggaggcatgcgggccgagatc
gcaggccggtacgccgagcgcggcacggcctcgctggacggcgagtacgccgtgtcggcg
caaaccatcggaatcgccggggcgctgcgccagggcaggggagcgacggcgctcgtcgcg
cggcaggagatgacgctggccggcaggctgggcctggccggcccggtccgcctcgatgcg
ggcggggcgctgtcgaacacggggatggcgagcgcgtgcgaccgcctcgccgtcacggcc
gcgtcgttcgacaatgcggcaggcggcctgctgtccgccggcagtgtcgacatcgctgtg
cgcggggcggcgcgcaacgccggccgcttgctgtccaaccaggacatcgtgcttggcgcc
gcgtcgttctacaacgccgcgcaggcggaggcgcgcggaaacttcgccgcgacggtcggc
gcggcgctggaaaaccgcggcagcctgaaggccggcggcgacctcacgctgcgggcggca
cggatcgacaaccatggcgtggcggccgccggccacgacgtcggattgcgatcgccgcaa
ctgcgcaattcgggccaggtcgccgccggccacgacatccgcatcgtcgaaggccgcgag
ctgcgcaatccgggcaggctcgatgcgcgcaacgatatcgagctggcggtggacgactac
gccaatacgggctcgatccatgccgatggcaatgccacgcttgcgctggcgcggggcacg
gaccgcgacctcgtgatcgacacccccgatatcctgcccgtcgcgctaggcgctttgcgc
gtcaaggccaggtcgttgcgcgtcaacaccgaaatcggcgtcccgggcagcctggacgtg
caaacgcagggggatatcgacaacaggcaggccatcgtcgccggcgggaacctcaagctg
gcctcggcgtccggggcgctgaacaacgcagccggcgccttgttgtgggcgggggcggat
atggcgctgcgggcgcgccgaatcaccaacggcaaggcggcgttgatcgagtccgggggc
ggcatgcggctggcggcgcgggacacgctcatcaacgatctgggcagcgtgcgggcgggc
ggcgatctgcgtctggatgccgcgcgtatcgagaaccgggcgacgctgaccggccatgta
cggcacgccggcgagaatacggtgggcggcggtggctatggtttctggcgcggcctcgcg
tatctggactatcggttgcgctacgggaacggggcggcggtggcggcgccgttctacgac
gtggcgctgcaggcggggcaatcgcgcatcgagagcggcggcgatttgtacgtgaaccgg
gagctggggccggggcgcagggggcatctgcgcaacgaaggcacgatccaggccgtcggg
catgcctacatcgacggcgatgtggagaaccgttccctgtcgcgggaagtgtccctggcg
gattatttgcgcacgccgctggcggccgcgatcgaactgaaagtgaccgatagccgcgcc
gcgttgacgccggcctactggtcattccgcacgctgtacgagctgctcgactatctggtg
ggcgaaaaccgctgggaaaccatctggggcttttacgatacgtatacggattgggccacc
aatacgctgaagaatctcgatctgggctacgtgagcccgccgccgccgcaggcgccgccc
gtgcccgccaagcccgagttgtcgctgccggatgggagtgcggactcgcccgccgcccgc
caggcgttggccgattaccgggaggcgctgcgcgaatacgaggcggcgcgggcccaggcg
cgcgccgccgaggcatatggcgaggcgcaacgccaggtgcgcgagatcctggcggcgcgc
tacggcgcggacaggctggccggtctggatacggaaaccgctgcgctcgatcgcgtcatc
ggcgattacgccgcggcgctggcgcgcctgggcgatgacgagccggccagggcgcaggcc
ttgcgcaagcagtatgagcaggccgtggaccgcatccagctggcgccggccacgcccggg
cgcgcgttgctggcgcgcgcgctgtcggcggcgttgggggcggattggcgcgcgcagccc
catcccgtactggtgcagcgctggaacgatttcaaggccggccggcgcggcgcgccgctg
acgttctacccccaggcgcagacggtgctggccgcgggcaagggggtgacgctgtccgac
gggtacctgcgcaatggcgagaatgccgcgcgcaaccggggacggcccgacacgttgcgc
atcggcgagcacaaggtggagacctccggcggctcgttcgatgcgctgcgcggcctgggg
ctggaaacgcgcctggatatcgatggcgcgctggaggcggtgctggccaatcggcatctg
ttcgcgcgcgtcggggatcagcctgccgcgtcgagcgttgccgtgcccgcggccatgccg
gcgccgcagggcgacgcggatccggcggccctgcgggacgtaccccgcaagccggtggcg
cccgccgtggccttgccgcagccactgatcgaaacccgcatcaagtatctcgaccaaggc
ggattctacggttcgggttacttcttcgagcagatcggctaccagcccgatcgcgccacg
cgcgtggcgggcgacaactatttcgataccacgctggtgcgcgagcaggtgcggcgcgcc
ctgggcggctacgaaagccgcctgcccgtgcgcggtgacgcgttggtggccaggctgatg
gagtcggccgggacggtcggcaaggcgctgggcctgaaggtgggtgtcgcgccgaccgcg
cagcagctcaagctggcggaccgcgatttcgtctggtacgtggataccgtgatcgacggc
cagaaggtcctcgctccccggctgtacctgaccgaggcgacgcgccagggcatcacggat
cagtacgccggcggcggggcgctgattgcctccggcggcgacgtaactgtcaatacggac
ggccatgacgtcagttcggtcaacgggctgatccagggcaggagcgtcaaggtggacgcg
ggcaagggcaaggtcgtggtggccgacagcaagggggcgggcggcggcatcgaggccgat
gacgaggtcgacgtctcaggccgggatatcggcatcgagggcggcaagctgcgcggcaag
gatgtcaggctcaaggccgacacggtcaaggtcgcgacctcgatgcggtacgacggcaag
ggcaggctggcggcgcgcggtgacggcgccctggatgcgcaaggcggccagctgcatatc
gaggccaagcgcctggagacggccggcgcgacgctcaagggcggcaaggtgaagctggat
gtcgatgacgtcaagctgggcggcgtgtacgaggcggcgtccagctacgagaacaggagc
tcgacgccgctgggcagcctgttcgccatcctgtcgtcgacgacggaaaccagccagtcg
gcgcgcgcgaaccattacggtacgcgcatcgaagccggcacgctggaaggaaagatgcag
aacctggagatcgaaggcggttcggtcgatgccgcgcatacgaacctgtccgtggcccgc
gacgcgaggttcaaggccgccgcggatttcgcgcacgccgagcatgagaaggaggtgcgc
cagctgtttctcggcggcaaggtgggggcgggcggctacgaggcgggtttcagcctgggc
agcgaaagcggtgtcagcagccatgccgggcgcggcgcggcgtccagcgcgagcgcccgg
gtcggctgggaaagcgtttgggagaagagcgcctcgtcgcgcaagacgtaccgcaacgcc
gacctgcgcctgggcgatggcttgctcgccgtcggcggcgtgctggacttcggcggcgcc
gacatcaatcgagaccgctacggcggcggcgcagaaggcgaacccggcttgcggctgcgc
ggcggcgaggtgcgcaccaccaagtacgtggataccgaacacaccgtgcgcagcggcggg
cgcgtcggactggagctgggcgtcgatggcagcgtcaatccgcaggtgaccagcagccgg
ctgggccggagcctgacgcaggccggggacggcagggggatcgacggcggcctgatgttc
ggccaggcgttgagcacggcgttccagagcgtcatggccgatacgatcagcagcacgctg
agcgcgagcctgcggacggagtggtggaacgagagccgcaacgccacctcggagaacctg
acgcacgtgggcggcaatgcccgcatcgaaagcggcgcgggcgacatggccctggccggc
gtacgctttgacggtggtcgcgaggtcgacttgcggtcggccggcgcgttgcgcatgcgg
tcggccgaatcgcgcgagcagcgcacgcgcgacgcgcacagcctgtcgctcgacgcccgc
ctggccatgggcgccaatctcgtcaagggcgacgcctatgtccgcggcacggcggggctg
agcgggcaccatgagcacgcggcctccgaacggcacacgcatggccggacgggcgtgcgg
gccgccaatgtgcatctgcaggcggcgcgcgacctggtcatgcagggcgcgcgcgtgcag
gccgcgcaaggcgcgcgggtcgaggtcggcggcgcgctgtccatggccagcgtgcaggat
gtgcatgacgaaagccacacgtcggcagactggatggcggcggccggcgcgcatgcgtcg
accggcaacggattcaagccgcagccggtggcgcaggtcggggtgtcgttcagccacggc
cacgaccgtggcgccatcgtggcgcagcgtacgggcattgccgcgggcggccccttgtcg
gtgcgcgtggcgggcgatgcgcaattgatcggcgccgacctggtgtcgaccgccgggcag
ggccgcgtgcaggtgggcggccgggtgcgcgccgaacagttggccgaccggcgcgaccgc
gacggcggctcggcgggggtgtcggcgccggcgctgctttcgaccagcacccggcctacg
ctggtggtcagcggcgggcggctggagcgcgaccactacgatgcggtgcaccgctccgtc
atcgcggtgtcgccgggcggcttggcggccgccgatggggtgtcgggccatttgcagcgc
gatccggtgacggggctgcgggtcttgcgcgacgagcactgggccggcggcgatatggcg
ttcacgctgggctcggtgcccaagttcgaccgcggcaagtatgcgccgccgcggcccgat
acctcggcgccaggcggatcgcccttttcgctgcatcgctag

KEGG   Bordetella pertussis Tohama I: BP2907
Entry
BP2907            CDS       T00139                                 
Symbol
fhaL
Name
(GenBank) adhesin
  KO
K15125  filamentous hemagglutinin
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe05133  Pertussis
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    BP2907 (fhaL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bpe00536]
    BP2907 (fhaL)
Glycosaminoglycan binding proteins [BR:bpe00536]
 Heparan sulfate / Heparin
  Microbial pathogens
   BP2907 (fhaL)
SSDB
Motif
Pfam: Peptidase_C80 Stv TPS Fil_haemagg_2 ESPR
Other DBs
NCBI-ProteinID: CAE43179
UniProt: Q7VV06
LinkDB
Position
3085865..3098455
AA seq 4196 aa
MNKHCFKLVHSPALGMLVPVHEHRTGRPLRGARRAMAVTLAVLAPAGAAAAGGIAPQGAT
QVAPARNGVPVIQIAAPDATGISHNRYTEFNVRQPGVVLNNSTAEGVSALAGRISGNPGL
RGPARAILNEVTGVSPTTLEGALEVFGPAADVLVANPNGLTANGLSTINIRGLTLSTGRP
GAGGVLDVARGRLEIGPHGVNTAGLSYFDLVARTVALHGPVGAGDGQPPADINVVAGANR
YDYGRRTRLQPTGRPAAAPDASAGHAIDGSAAGAMYGRHITLVSSDAGLGARHRGLVSAA
GHIAIDAAGGVSVQALAAHAASDGTAGSATIRAGGDALIGSVIAFGGDIEVRAAAGRIAT
HGALNAPRGRVRLQAGDALAVHGPVQAARVALATRGDASIAADLHATRDGVSLAARNATL
AHARVIATPPAAQARPSTPAIDIALSGTLTLRGTLHDADGDGRRIEGTSVALANGMPVIV
DTRQPQRAVPNALLASDAGLYAASQPISIRAAGLRNEGGAIDSTGTGQGHIGLRIGGPAV
NLGYIATHGTLEATVDGTLENRMLLSAAALRVATHDLSNHAAMTASGPDTGTPALDLSVQ
HRVENAGSLLAARGALRLRGGAELSIVNQPAGFMLAHGQDIAAARLANAGTLSSTAAGTL
TLAGDLENSGVLQSAHALRVQARRIASRGRLATATDGAGLTLAADENLTLAGRTSSAGAL
LARAGAALVNEGIVTARQDLSWRARDIVNDAAGNVVARSVDMRAGQGFDHRGAIGSVTDL
VLKAARIDSAGVLRANQDIDMHADDAMRLKAGARTLAGRDLALAADQLEQSGMAQAGRTL
TATAGALENDGLLDAADAKLRTTRAFVNRGQIQADMLQAQGPQIRNAGVLRTGALLALQA
AGRLENTGGMAASGSLSIAAAGPFANSGTMGANGDASFALSSFANTGSISVGGDLALRLP
DVELTLDADHRLPVSQGTTLLQVASLDNRARSETPGRLSVQARGAIRNQDTLAAGQGLWL
ESAANDIENGAGALLWSGADLRLRGTRIINREAAIIESAAGMVLDARAEIDNGLGIIRAG
GDLWADAPLLRNSGRLGGRIVPAGDAAIGGGTYDHYHSAAVVWHELFTAGAAGIRVPRYD
GKDVRVAQSVVQAGGNLHLNQGEQKGRQARVSNQGRIEAAGMALVDGNVDNASLHLSLSV
DEYLRRPLAAPIVLRATDSRAQHVIPAFWKFHTLYEFLDFLLSNNEPRYIWGYYRTWPEW
AFQTLRNLDLGYAGAPDPTAPPVPRPPVLDPQAKASTTPAAQALVAQYHKDLAEYATALE
AAQRAEAIRTARQRVDGALRARYGEKLAQLKTRTPEVDAAVAALAQTIFDARAKPAAEVE
KLIAAALCSPRAQACAAGTARIAQLLDQASLPPRRPAVALFAQAMAAVLGPDWHGPVGHA
TLMARYADFKRRVATQGRAAGGELAFYPAQQTVLAGGAGLVLSGGRVTNGENVAGLLARN
MTVHIGEQRIETPRGSIDAIRHPDAGPAVTVKDSIHALLENRRLFARTAPARAAAGPGGP
DVPATPPGLPQPLYETRLSYLDQSHYYGSQYFFDLIRYRPDRPLRTIGDNYFETRLIREQ
IARAMGGHEYRNAVRGLALVQSLMDAAPLAAAELGLRVGQAPTAEQLARATRDFVWYVRE
TVDGQEVLVPRVYLTRATRTAASATREAGGALMASAGTVLADTGGAAIESGNAAFLGKDV
ILDAAGGAVRLINDKGIAGGARALGTLAIRGGDIAIQGGLLDAAQAYLTGERVSLAASAR
YDAHGRLVSRHDARLNGRADAAGLLYIAAKRLDSAGATLSGDHVRLEADKVRLGGLYDVD
SSYSQTSRYGLGKAWWLLSSQTETATASHARFQGTTLEGAILSGRATDMDIEGSSARFQQ
TDLQVAHDFKARAAADYAYAERAKRVDQLFLRLSAGAGGYEAGIDLSAQGGLQAHAGRGQ
TAGAHASAGFESTREYERSRMTHYRNADLNFGAGLLAVGNTADLGGADINRDRYGQGAST
ASDAIPGDLLRIRAARVAATKYLDVTDSLTASSYLRASIDGALTSSVATAATRLGDTLAE
ARQENSQVHAGQMALQMAGEATQLATTDTAALSISATFAAGYADSHRNTQTENTNYFGGN
LDIRATEQDIDLAGTKFSGADWLALSARRDINVRAAASRYQESGEQHDLQLHQTINAGAN
AMQAAAGVGVTAGLSGSHMVRHGAGQTYEGSALRATQLHLQARDLNLDASMAQATRMDLH
VARDLNAISRQDEQRFAQTGGNWEVSLGAAIQNRTLVAPVGTIGAGVRHEHDYQALTQNG
QAGLLASQGLRATVGRDARLRGAIIADASNQGGMDIAGRIHAEALHDYRDKDGFETGASV
GISSTTLNPTLSLTLGRPAVEQYRAVRQATIAMGAAPGAPRYTARGGVSGRLNTDSGQAV
VVQRAERWASARTEFSFDQPSRRDKADSGSPGARPAHPGAAKAPALPLARPLTSVLAGPS
STSPTANPAAAPGIAAQPAPASPGRDAPKPDPYANRVIVQLAQDDVATQAAQALFHKHAE
QSDWYRQADDGSLHPVHPLRAAAAGPTKIQLVGHGSADRQALSGHDGHAVAGIVQQLRER
LPPAAALAKVALVGCDTDCASGASLRGDVAQRLAADGAQPAPAVSGYIGRLEVDAAGRKH
AVAQGGLGDVDPEARAQGTQPVPRVFSHGPVNIAQSGQARQLVIDGHGSWVRPDRAVAPS
YSGTVRLPAGTRMHFYSDDGQMVSAIPLRNIPDNPERAWRAQPFSERISSERIRRVANAA
KVPFDVARQGFETSTQVREIAAPGTAVKNYLLTPIDPQRDAALAFHQSRSQADVDLASAA
PGKGALLSDLLLAVAASGHSYPLIHYTCCRGEFQRPGSDTPSPQLPPHELLIRSWLASSA
PVHALPLPPSSRGTLPGADPYALRSIVQLGTDAATARAAAALHGKHPANSNWYLQTRDGG
LEPVRQAAGPAAGPHKVQFVGHGDVYHGVPLLGGNAAATLADLLNQVEQHSPAGARLDKI
ALVGCDTDCTGRPSLREPFRQSLAARPDAPALTVTGYIGRIDVDSAGRKRRVATGGLGDR
PPADEPASPRPPAQPAAPGPGAATPSSAPSAPVAARLFTHGPITLSQSENARQLLIQGHS
GWTRPPAGTSGAGEIPAGWLRLPSGTRMHFYSVDNQQTSGVPVQAIPRNPELAWLGRPFV
REFPASVIRQFAHARQAPFDVARAALVESTRVQEVAAAGALVKNYRLAPAIDPLVTGVEQ
FHAQRRQGDVDMAVARERASLSDVLAAVEASGHHYPLLHFTCCRGETTPPGAPPDAVAPP
LAPVSARYLQQWRERSGVAQPRPPTPLGAEPPVHGPDRYGHRTIVQLGSDALTETAARRL
FRKHAGNASWYSQDASGQLTQVRAPAAPATGPQKIQFVGHGSILEGMPLLGGNNAAQLAR
MLPAIRQGLPATARVEKITLVGCNTGCASRASLRNLLNHYLITTAGLSAEVKGYAGRVDV
DAAGHKQIVEQGGLGNTPPPEAAPAPRVFRHGNVTLSQSGEARQLTIVGHGFWPRPGPAD
QPDGASPPGWVRLPANTSMYFYSRENQLVGGLPSQAALRAPMLAAQGQGAAELFSRAVIR
GFAHRHQLPFDVARHTLVGATRPQDIGEPGALIKDYVVSPAPETGLGAIEDFHAARQQPD
MDLAQAAPGSEIRLSEILQAVAQSGVRYDLIHYACCRAEIPATDTPTQQVATPVPAPDKL
VIQQWHSGAGAARPPSPQAQAQAPYGPDRYAHRVIVQLGSDTVTESAARRLFRKHAATSL
WYGQTLEGTLMLKQGGDTPAAGPLKIQFVGHGGPRYSMPLLGGNTPAELAQMASTIQHAG
PPSQLEKVTLVGCQTDCVARPSLRKLFSTALATEHGLTPAVTGYAGRVDVDAAGRKRIVE
QGGLNEPRAQAGASTAAPNRIVQSVAHGVALSQSGQARQLVVLAHGGWKDKTTSRYLRRV
RGDGYTELPANTRIDYYTEDGIPTKGFAVYQEVTARANDTYTGLQPTLAISPADLEALAR
MHNTSPQALTDAMLASAVGRRESIIGAATMKDYALYYHEQFALNFLRRHNADGSSADVDL
AIITEPTHKRHLSDVLKAAGESGAHYDVVHFGACRVGRCRNAAAEMGASATSRLPP
NT seq 12591 nt   +upstreamnt  +downstreamnt
atgaacaagcattgcttcaaactggtccattccccagccctcggcatgctggtccccgtc
cacgaacaccgtaccggccgcccgctgcgcggcgcgcggcgggcaatggccgtgacgctg
gccgtgctcgcgccggccggcgcggcggcggcgggcggcatcgccccgcaaggcgcaacg
caggttgccccggcccgcaatggcgtaccggtgatccagatcgccgctccggatgcgacg
ggcatttcgcataatcgctacaccgaattcaacgtacggcagccgggcgtggtcttgaac
aacagcacggccgaaggcgtctccgccctcgccggccggatcagcggcaatcccggcctg
cgcgggcccgcgcgcgccatcctcaacgaggtgaccggcgtctcgcccaccacgctcgag
ggcgccctggaggtattcggcccggccgccgacgtgctcgtcgccaaccccaatggcctg
accgccaatggtctgagcaccatcaatatccggggcctgaccctgtcgaccggacgcccg
ggcgccggcggcgtgctggacgtcgcgcgcggcaggctggaaatcggcccgcacggcgtc
aataccgccggcctgtcctatttcgacctggtcgcccgcaccgtggcgctgcacgggccg
gtcggcgccggcgacggccagccgcccgccgacatcaatgtcgtggccggcgccaaccgc
tacgactacggacgccggacccgtctgcagccgaccgggcggcccgccgcggcgccggac
gccagcgccggccacgccatcgacggatcggccgcgggcgccatgtacggacgacacatc
acgctggtttccagcgacgccggcctgggcgcgcgccaccgcggcctggtttcggcggcc
ggccatatcgccatcgacgcggcgggcggcgtttcggtgcaggcgctggcggcgcacgcc
gcctcggacggcacggccggttccgccacgattcgtgccggcggcgacgcgctgatcggc
agcgtaatcgcgttcggcggcgatatcgaggtgcgcgccgccgcgggccggatcgcgacg
cacggcgcgctgaacgcgccgcgtggccgcgtgcggctgcaggccggcgacgcgctggcc
gtgcacggcccggtgcaggccgcccgcgttgcgctggcgacacggggcgatgcatcgatc
gccgccgacctgcacgccacgcgcgatggcgtcagcctggcggcgcgcaacgccacgctg
gcgcatgcccgcgtcatcgccacgccgcccgcggcgcaggcgcgaccctccacacccgcc
atcgatatcgccctgagcggcaccctgaccctgcgcggtacgctccacgacgccgacggc
gacggccggcgcatcgagggcacgagcgtcgcgctggccaatggcatgcccgtcatcgtc
gacacgcggcagccgcagcgcgccgtcccgaacgccttgctggcctcggacgccgggctg
tacgcggccagccaacccatatcgatccgggccgccgggctgcgcaacgagggcggcgcc
atagacagcaccggcacggggcaaggccatatcggcctgcgtatcggtggcccagcggtc
aacctgggctacatcgccacgcacggcacactggaagcgacggtcgacggcacgctggaa
aaccggatgctgctgagcgcagccgcgctgcgcgtggccacgcatgatctgtccaaccac
gcagcgatgacggccagcggtccggacaccggaacgcccgcgctcgacctctcggtccaa
caccgggtggaaaacgccggctcgctgctggccgcgcgtggcgcgctgcgcctgcgcggc
ggcgccgagctgtcgatcgtcaaccagccggccggcttcatgctcgcccacggccaggac
atcgccgccgcccgcctcgccaatgccggcacgctgtcgagcaccgcggccggcacgctg
acgctggcgggcgacctggaaaacagcggcgtgctgcaaagtgcccatgccctgcgcgtg
caggcgcggcgcatcgcctcgcgcggccgtctcgccaccgcgaccgacggcgccggcctg
acgctggccgccgacgaaaacctgaccctggcgggccgcacctccagcgccggcgcgctg
ctggcccgggccggcgctgcgcttgtcaatgaaggcatcgtcaccgcccggcaggacttg
agctggcgcgcccgcgacatcgtcaacgacgcggccggcaacgtcgtggcgcgatcggtc
gacatgcgcgccggccaaggattcgaccaccgcggcgcgatcggcagcgtgacggacctg
gttctgaaggcggcgcgcatcgacagcgccggcgtgctgcgggccaatcaggacatcgac
atgcatgccgacgacgccatgcggctgaaggccggcgcccgcacgctggccggccgcgac
cttgccctggccgccgaccagctggagcaatccggcatggcgcaggcgggacgcaccctt
acggccaccgccggcgcgctcgagaacgacggtttgctcgacgcggccgacgcgaagctg
cgaaccacgcgcgccttcgtcaaccgcggccagatccaggcggatatgctgcaggcgcaa
gggccacaaatccgcaatgccggcgtgttgcgcaccggcgcgctgctggcgctgcaggcc
gccggccggctcgagaataccggcggcatggcggccagcggttcgctgtccatcgcggcg
gccgggcccttcgccaattccggaacgatgggcgcgaacggcgacgcctcgttcgcgctg
agcagctttgcgaacaccggcagcatcagcgtcggcggcgacctggcgcttcgcctgccg
gacgtcgagctgacgctcgatgccgatcaccgcctgcccgtgtcgcagggaacgacgctg
ctgcaggtcgccagcctggacaaccgcgcgcgcagcgagacaccgggccggctgtccgtc
caggcgcgcggcgcgatccgcaaccaggatacgctggccgccggccagggcctgtggctg
gaatccgccgcgaacgacatcgagaacggcgccggcgcgctgctgtggtccggcgcggac
ctgcggctgcggggcacccggatcatcaaccgcgaggcggccatcatcgaaagcgccgcc
ggcatggtgcttgacgcccgcgccgagatcgacaacggcctgggcatcatccgcgccggc
ggcgacctgtgggccgatgccccgctgctgcgcaactcgggacgccttggcggccgtatc
gtcccggcaggcgacgcggcaataggcgggggcacttacgaccactaccattcggcggcc
gtcgtctggcacgaactgttcaccgccggcgcggcgggcatacgcgtgccacgctacgac
ggcaaggacgtgcgggtcgctcaatccgtggtgcaggccggcggcaatctccacctcaac
cagggcgagcagaaaggcagacaggcccgggtctccaaccaggggcgcatcgaggcagcc
ggcatggcgctggtcgacggcaacgtcgacaacgcatcgctgcacctgagcctgtccgtg
gacgagtacctgcgccggccgctggccgcccccatcgtgctgcgggctaccgacagccgt
gcgcagcacgtcatcccggcgttctggaaattccatacgctgtacgaattcctggacttc
ctgctgtcgaacaacgagcccagatacatctggggctactaccgcacctggccggaatgg
gcattccagacgttgcgcaatctcgacctgggctatgccggcgcgcccgacccgacggcg
ccgccggtgccccgcccgcccgtactcgacccgcaggccaaggcgagcaccaccccggcc
gcccaggcgctcgtcgcgcaataccacaaggacctggccgaatacgccacggcgctcgag
gccgcgcagcgagccgaggcgatacgaaccgcgcggcagcgcgtggacggggcgctgcga
gcccgctacggcgagaagctggcgcagctgaagacccgcacccccgaggtggatgcggcg
gtcgccgcactggcgcagacgattttcgacgcacgcgccaagcccgccgccgaggtcgag
aaactgatcgccgccgccctttgctccccccgggcgcaggcctgcgccgccggcaccgcg
cgtatcgcgcaactgctcgaccaggcctccctgccgcccaggcggcctgccgtggcgctg
ttcgcccaggccatggcggcggtgctcgggccggactggcacggcccggtcgggcacgcc
accctgatggcgcgctacgccgacttcaagcgccgcgtcgccacccagggacgcgcagcc
ggcggcgaactggccttctatccggcgcaacagaccgtgctggccggcggggccggcctg
gtactgtcgggcgggcgcgtcaccaatggcgagaacgtcgccggcctgctggcccggaac
atgacggtgcacatcggcgaacaacggatcgagacgccgcgcggctccatcgacgcgatc
cgccatcccgacgccgggcctgcggtgacagtcaaggacagcatccacgccctgctggaa
aaccggcgcctgttcgcgcgcaccgcgccggcgcgcgccgccgccgggccaggcgggccc
gacgtgccggccacgccgcccggcctgccccaacccctgtacgaaacgcgcctgagctat
ctcgaccaaagccactattacggctcccagtatttcttcgacctgatccgctaccggccg
gaccggccactgcggaccatcggcgacaattatttcgagacccggctgatccgcgaacag
atcgcgcgcgccatgggcggccacgaataccgcaacgccgtgcgcggcctggcgctggtg
cagtcgctgatggatgcggcgccgctggcggccgccgagctggggctgcgcgtgggccag
gcgccgaccgccgaacagttggcgcgcgccacccgcgacttcgtgtggtacgtacgggaa
acggtcgacggccaggaggtgcttgtgccgcgggtatacctgactcgcgcgacgcggacg
gccgcgagcgccacgcgcgaggccggcggcgcgctcatggcgtcggcgggcacggtgctc
gccgacaccggcggcgcggcgatcgaatccggcaatgcggcattcctcggcaaggacgtc
atcctggatgctgcgggcggcgctgtccgcctgatcaacgacaaaggtatcgccggcggc
gcgcgggcgctgggcacgctggccatacgtggcggcgacatcgcgatacagggcggcctg
ctggacgccgcgcaggcctacctcacgggcgagcgggtcagcctggccgccagcgcgcgc
tacgatgcgcacggccggctggtatcgcgccacgacgcgcgcctgaacggccgcgccgat
gccgcgggcctgttgtacattgccgccaaacggctggacagcgccggcgcgacgctgtcg
ggcgaccatgtccgcctggaggcggacaaggtccggctgggcggcctgtatgacgtcgac
agcagctactcgcaaaccagcaggtacggcctgggcaaggcttggtggcttctgtcctcg
cagacggaaaccgccacggccagccacgcgcgcttccagggcacgacgctggagggcgcg
atattgagcgggcgcgccacggacatggatatcgagggcagcagcgcccgcttccagcag
accgacctgcaggtcgcgcacgatttcaaggctcgcgccgccgccgattacgcgtacgcc
gagcgcgcaaagcgggtcgatcaactgttcctcagattgtccgccggcgccggcggctac
gaggccggcatcgacctgagcgcgcaaggcggcctgcaagcgcacgccgggcggggccag
accgccggcgcccatgcctcggccgggttcgaatcgacgcgcgaatacgaaaggtcgcgc
atgacccactatcgcaatgccgatctcaatttcggcgcgggcttgctggcggtgggcaac
acggccgatctgggcggcgccgacatcaaccgcgaccgctacggccagggcgcgagcacg
gcgtcggatgccatccccggcgatttgctgcgcatccgcgccgcgcgcgtggccgccacc
aagtatctcgacgtcaccgacagtctcacggccagcagttacctgcgcgccagcatcgat
ggcgcgctgacctcgagcgtggcgaccgccgccacccgcctgggcgatacgctggccgag
gcccggcaggaaaacagccaggtgcacgccggccagatggccctgcaaatggcgggcgaa
gcgacacagctcgcgaccaccgacaccgcggcgctcagcatcagcgcaaccttcgcggcg
ggttacgccgactcgcacaggaatacgcagaccgagaacacgaactacttcggcggcaac
ctcgacatccgggccaccgaacaggacatcgacctggccggaacgaagttcagcggcgcc
gactggctggcgctgtcggcccggcgcgacatcaacgtccgcgctgccgccagccgctac
caggaatcgggcgaacagcacgacctccaactgcaccagaccatcaacgccggcgcgaac
gccatgcaggccgcggcaggcgtcggcgtaaccgcgggcctgagcggctcgcacatggtc
cgccacggtgccggacagacttacgaaggctcggcgctgcgcgccacgcagctgcaccta
caggcgcgcgacctcaatctcgacgcgtcgatggcccaggcgacccgcatggacctgcat
gtggcgcgcgacctgaatgccatctcgcggcaggacgagcagcgattcgcgcagaccggc
ggcaactgggaggtctcgctgggcgcggcgatccagaaccggacgctcgtggcgccggtc
ggtacgatcggggcgggcgtgcggcacgagcacgactaccaggccttgacgcaaaacggc
caggcgggcctgctggcctcccagggcctgcgcgcgacggtggggcgagacgcccggctg
cgcggcgctatcatcgccgatgcgtccaaccagggcggcatggacatcgccggccggatt
cacgccgaggccctgcatgactatcgcgacaaggatggattcgagaccggcgcgagcgtc
ggcatatcgtcgaccacgctcaaccccaccctctcattgacgctgggccgcccggccgtc
gaacaataccgggccgtgcggcaggccaccatcgccatgggcgccgcgccgggcgcgcca
cgctataccgcgcggggcggcgtgtcgggccggttgaataccgactccggccaggccgtc
gtcgtgcagcgcgccgagcgctgggcatctgcgcgcaccgagttctcgttcgaccagcca
tcgcgccgcgacaaggccgacagcggctcccctggcgcgcgacctgcccacccgggcgct
gcaaaagcgcccgcgctgccgctcgcgcgcccattgacaagcgtcctggcaggcccatcg
tcgacaagcccgacggccaacccggcggcggcgcccggcatcgccgcgcaaccggccccc
gcttcgccaggccgcgacgcccccaagccggacccctacgccaaccgggtcatcgtccag
ctggcgcaggacgacgtcgccacccaggccgcgcaggcgctgtttcacaagcatgcggag
caatccgactggtaccggcaggcggacgacggcagcctgcaccccgtgcatccgttgcgc
gcggccgcggccggccctaccaagatccagctcgtcggccacggctcggcggaccggcaa
gccttgagcgggcacgacggccatgccgtcgccggcatcgtccagcaactgcgggagcgc
ctgccgcccgctgcggcgctggcaaaggtggcgctggtgggctgcgacacggactgcgcc
agcggcgccagcctgcgcggcgatgtcgcgcaacgcctggcggccgacggggcgcaaccg
gcgcctgccgtaagcggctacatcggccgcctcgaggttgacgccgcgggccgcaagcac
gccgtggcgcagggcggcctgggcgacgtggatcccgaggcgcgcgcgcaaggcacgcag
cccgtgccacgggtgttttcccacggccccgtcaacatcgcgcaaagcgggcaggcccgg
caattggtcatcgatggccacggcagctgggtgcggcccgaccgcgccgtcgcgcccagc
tacagcggcacggtgcgcctgcccgccggcacacgcatgcatttctactcggacgacgga
cagatggtcagcgcgattccattgcgcaatatccccgacaatccggagcgggcctggcgc
gcgcagccgttcagcgagcggatttcctccgagcgcatacggcgcgtggccaacgcggcc
aaggtgccgttcgacgtcgcgcgccaggggttcgaaacctcgacccaggtacgggaaatc
gccgcgccgggcaccgcggtcaagaactacctgctcacgccgatcgatccgcagcgcgat
gccgccctggcgttccaccagtcgcgcagccaggccgacgtggatctcgcgtcagcggcg
cccggcaagggcgcattgttgtcggacctgctgcttgccgtcgcggcctccggacattcg
taccccctgatccattacacctgctgccggggagagttccagcggcccggatcggatacc
ccgagtccgcaactgccgccgcacgaattgctgatccgatcctggctggccagctcggcg
cccgtgcacgccctgcccctgccgccctcgtcgcgcgggacactgcccggcgccgacccc
tacgcgctgcgcagcatcgtgcagctcggcacggacgcggcgacggcacgagcggccgcg
gcgctgcatggaaagcaccccgccaacagcaactggtatctccagaccagggatggcggg
ctcgagcccgtacgccaggctgccggcccggccgccggcccgcacaaggtccagttcgtc
ggccacggcgacgtctaccatggcgtgccgctattgggcggcaacgccgcggcaacgctg
gcggacctgctgaaccaggtggaacagcacagcccggccggcgcccggttggacaaaatc
gcgctggtgggctgcgacaccgactgcacaggccgccccagcctgcgcgaacccttccgg
cagtcgctagccgcccgccccgacgcgcccgccctgaccgtcacgggctacatcggacgc
atcgacgtcgacagcgcggggcgcaagcgccgcgtcgccacgggcggccttggcgatcgg
ccgcccgccgacgagcctgcctcgccgcgtccgcccgcgcagcccgcggcgcccggccct
ggcgcggccacgccctcctccgccccgtccgcgcccgtggcggcgcggctgttcacgcat
ggccccatcacactgtcgcaaagcgaaaacgcccgccaactgctcatccagggccactcc
ggctggacccgtccgccggccggaacgtccggcgccggcgagatcccggcgggctggctg
cggctgccgtccggcacccgcatgcacttctacagcgtggacaaccagcagacatcgggc
gtgccggtacaggcgattccacgcaatcccgaactggcctggctaggccggccgttcgtc
agggaattccccgcctcggtcatccgccaattcgcccatgcgcggcaggcgccgttcgac
gtggcccgcgcggcgctggtcgaaagcacgcgcgtgcaggaagtggccgccgccggcgcg
ctggtcaagaactacaggctcgcccccgcgatcgacccgctggtcaccggcgtcgagcaa
ttccacgcgcaacggcgccagggcgacgtggacatggccgtcgcgcgcgagcgcgccagt
ttgtccgacgtactggccgccgtcgaggcgtccggccatcattatccgctgctgcatttc
acctgctgccgcggcgagaccaccccgcccggcgcgccgcccgatgccgtcgcgcctccc
ttggcgccggtttcggcgcgctatctgcagcaatggcgcgagcgctccggcgtggcgcag
ccgcgtccgcccacgcccctcggcgcggagccgcccgtgcatgggccggaccgctatggc
caccggaccatcgtccagctgggcagcgacgcactgaccgaaacggccgcgcgccgcctg
ttccgcaagcatgccggcaatgccagctggtacagccaggacgcgagcggccagctgaca
caagtgcgggcccccgccgcgcccgccaccggcccgcagaaaatccagttcgtcggccac
ggcagcatactggaaggcatgccgctgctgggcggcaacaatgccgcgcaactggcgcgg
atgctgccggccatccggcaggggctgcccgccacggcccgggtggagaaaatcaccctg
gtcggctgcaacaccggctgcgcgtcgcgcgccagcctgcgcaacctgctgaaccattac
ctgatcaccacggccgggctgagcgcggaggtcaagggctacgccggccgggtcgacgtg
gacgctgccggccacaagcagatcgtggaacagggcggcctgggcaatacgccgccgccc
gaagccgcgcccgcgccgcgtgtattccggcacggcaacgtcaccctgtcgcaaagcggc
gaagcgcggcaattgacgatcgtcggacacgggttctggccccgccccgggcccgcggat
cagcctgacggcgcgtccccgcccggctgggtacgcctgcccgcgaacacgtccatgtat
ttctactcgagggaaaaccagctggtcggcggcctgcccagccaggccgcgctgcgcgcg
cccatgctggccgcacagggccagggcgccgcggagctgttctcgcgtgccgtgatccgc
gggttcgcgcaccggcatcagctgcccttcgacgtcgcccgccacaccctcgtgggcgcg
acccgccctcaggatatcggcgaacccggcgcgctgatcaaggactacgtggtcagcccc
gcgcccgagaccggactcggcgccatcgaggatttccatgccgcccgccagcagccggac
atggatctcgcacaggctgcgccaggctccgaaatcaggctgtctgaaatattgcaggcc
gtggcccagtccggcgtccgatacgacctcatccactatgcatgctgccgcgcggaaatc
ccggctaccgatacgccgacgcagcaggtcgccacgccggtgccggcgccggacaagctg
gtcatacagcagtggcattccggcgccggcgcggcacgcccgccttcgccgcaagcgcag
gcgcaggcgccatacgggcccgaccgctacgcccatcgcgtcatcgtgcaactgggctcc
gacacggtcaccgaatccgccgcgcgcaggctgtttcgcaaacacgcggcgacctcgctc
tggtacggccagaccctggaaggcaccctgatgttgaaacagggaggcgacacgccggcg
gccggcccgctgaagatccagttcgtgggccacggcggcccgcgctacagcatgccgtta
ctgggcggcaatacgcccgccgaactggcgcagatggccagcacgatccagcatgccgga
ccgccctcgcagctggaaaaagtaacgctggtcggctgccagaccgattgcgtcgcgcgt
cccagcctgcgcaagctgttctccactgccctggccacggaacacggcctgacgccggcg
gtcacgggctacgccggcagggtcgacgtggatgcggccggccgcaagcgcatcgtggag
caaggcggattgaacgagccgcgggcgcaggcgggtgcatcgacggcggcgccgaaccgg
atcgtgcagtcggtggcgcacggcgtcgcgttgtcgcaaagcggccaggcgcgccaattg
gtggtattggcgcatggcggctggaaggacaagacgacgtcgcggtatctcaggcgcgtc
cggggcgacggctataccgagctgccggcgaacacgcgcatcgactactacaccgaagac
ggcataccgaccaagggattcgcggtgtaccaggaagtcaccgcgcgcgcgaacgatacc
tacacaggactgcaaccgaccctggccatatcgccggcggatctcgaagcactggcgcgc
atgcacaatacgagcccgcaggcgttgaccgatgccatgctcgccagcgccgtcggccgg
cgcgaatccatcatcggggcagccacgatgaaggattacgccttgtactaccacgagcag
ttcgccctgaacttcctgcgccggcacaacgccgacggcagcagcgcggatgtggacctg
gccatcatcaccgagccgacgcacaagcgccatctgtcggatgtgctgaaagcggcggga
gaaagcggcgcgcactacgacgtcgtgcatttcggcgcgtgccgggtgggccgctgccgc
aacgccgcggccgagatgggcgcgagcgccacctcgcgcctgccgccatga

DBGET integrated database retrieval system