Bordetella pertussis B1917: B1917_1976 Help Entry B1917_1976        CDS       T03638                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism bpet  Bordetella pertussis B1917 Pathway bpet02024   Quorum sensing bpet03018   RNA degradation Brite KEGG Orthology (KO) [BR:bpet00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     B1917_1976 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     B1917_1976 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bpet03019]     B1917_1976 (hfq)    03036 Chromosome and associated proteins [BR:bpet03036]     B1917_1976 (hfq) Messenger RNA biogenesis [BR:bpet03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      B1917_1976 (hfq) Chromosome and associated proteins [BR:bpet03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     B1917_1976 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 SRP14 Motif Other DBs NCBI-ProteinID:  AIW92333 LinkDB All DBs Position complement(2095086..2095322) Genome browser AA seq 78 aa AA seqDB search MSNKGQTLQDPFLNTLRKEHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAI STVVPARAVNFQVEVPAE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaataaagggcaaactttgcaagatccgtttctgaacacgctgcgcaaggaacac gtgcccgtgtccatctacctggtaaacggcatcaagcttcaggggcagatcgaatcgttc gaccagtatgtcgtgctgctgcgcaataccgtgacccagatggtgtacaaacatgccatc tccaccgtggtgccggcgcgcgccgtcaatttccaggtggaagttcccgctgaataa

DBGET integrated database retrieval system