Bathycoccus prasinos: Bathy18g01200 Help Entry Bathy18g01200     CDS       T03089                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism bpg  Bathycoccus prasinos Pathway bpg03020   RNA polymerase bpg03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:bpg00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     Bathy18g01200   09124 Replication and repair    03420 Nucleotide excision repair     Bathy18g01200  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:bpg03021]     Bathy18g01200    03400 DNA repair and recombination proteins [BR:bpg03400]     Bathy18g01200 Transcription machinery [BR:bpg03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      Bathy18g01200   RNA polymerase III system    RNA polymerase III      Bathy18g01200   RNA polymerase I system    RNA polymerase I      Bathy18g01200 DNA repair and recombination proteins [BR:bpg03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       Bathy18g01200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_N Motif Other DBs NCBI-GeneID:  19010808 NCBI-ProteinID:  XP_007508226 UniProt:  K8ER33 LinkDB All DBs Position 18:join(234853..234888,235056..235229) Genome browser AA seq 69 aa AA seqDB search MIIPVRCFTCGKVIGNKWDTYLDLLQADYAEKDALDALELKRYCCRRMVMCHVDLIEKLL NYNTLERQE NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgatcatcccggtgcgctgtttcacctgcggcaaggtgattgggaacaagtgggacacg tatttagacttattgcaagcggattacgcggagaaagacgcgttagacgcgttagagttg aagagatattgctgcaggaggatggtcatgtgtcacgtggatttgatcgagaaattgctg aattataacacgctggagagacaagagtaa

DBGET integrated database retrieval system