KEGG   Paraburkholderia phymatum: Bphy_4826
Entry
Bphy_4826         CDS       T00704                                 

Name
(GenBank) citrate synthase
  KO
K15234  citryl-CoA lyase [EC:4.1.3.34]
Organism
bph  Paraburkholderia phymatum
Pathway
bph01100  Metabolic pathways
bph01120  Microbial metabolism in diverse environments
bph01200  Carbon metabolism
Brite
Enzymes [BR:bph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.34  citryl-CoA lyase
     Bphy_4826
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: ACC73932
UniProt: B2JS13
LinkDB
Position
2:1887960..1888775
AA seq 271 aa
MANGTRQAWETSVSDVEDASVYIRGYDLGELIGQLSFASSSFLLIRGRLPTPGESKMMEA
VLCSVLDFSLKKPGTVAARYCVSGNPSMVAGLATAVLSAGEYTLAPDAGGEFIASSFAEY
KGSGDSMSAVADLLVTGMRAKGLRVPGFGHPTFRYTDPRAQKLKAIAQENQVWGEMCDWY
EAIHAAFIKQANKPDLVINEVGMLAAILAQMEFTPAEMTGLALVSTMPGVIAHVSEELKS
KVRIRGVADVDAKYSRERKNLEEDLKVAGWR
NT seq 816 nt   +upstreamnt  +downstreamnt
atggcaaacggcacaaggcaggcgtgggagacatctgtaagcgacgtcgaagatgcgagc
gtttatatccgcggatacgatctgggagagttgattggtcaactgtctttcgcttcatca
tcgtttttgcttatccggggccggttgcctacaccgggtgagtcgaaaatgatggaagcc
gtgttgtgctcggtgttggacttttcgcttaaaaagccgggcaccgtcgcagcacgctat
tgcgtttcgggaaacccctcgatggttgcgggacttgctactgcggttctatctgcgggg
gaatacacgcttgctcctgacgccggtggcgaatttatcgcgagcagttttgccgagtac
aaaggcagcggtgactccatgtctgcggtagccgacctactggtgacaggcatgcgcgcc
aagggcctgcgcgtgccgggatttggtcatcccactttccgctataccgacccgcgcgcg
cagaagctgaaggcgatcgcgcaagaaaaccaggtgtggggtgaaatgtgtgattggtat
gaggcgatccacgctgctttcatcaagcaggcaaataagcccgacctcgttatcaacgag
gtcggcatgctcgctgcaattctcgcgcagatggaatttaccccggcggaaatgacgggg
cttgcactggtttcaacgatgccgggcgtgatcgcccacgtctcagaggagttgaagagt
aaagttcgcattcgcggtgttgcggatgtcgatgccaagtattcccgtgagcgcaagaac
ctcgaagaggatctgaaagttgccggttggcgctag

DBGET integrated database retrieval system