KEGG   Candidatus Brocadia pituitae: BPIT_13410
Entry
BPIT_13410        CDS       T07694                                 
Name
(GenBank) hydrazine oxidoreductase
  KO
K20935  hydrazine dehydrogenase [EC:1.7.2.8]
Organism
bpit  Candidatus Brocadia pituitae
Pathway
bpit00910  Nitrogen metabolism
bpit01100  Metabolic pathways
bpit01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpit00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BPIT_13410
Enzymes [BR:bpit01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.8  hydrazine dehydrogenase
     BPIT_13410
SSDB
Motif
Pfam: Multi-haem_cyto Cytochrom_c3_2
Other DBs
NCBI-ProteinID: BBO17049
LinkDB
Position
1537868..1539625
AA seq 585 aa
MGKFLKVTLASVIGFGAMGVAASLMTKEVKAVEIITHWVPHEVYGQIGEPDNNGKVFFSG
LGAKYMGYPKDSGAPPYPGKYSKFWKTLPAYRYYIPDYMYNRDEVRPSNPIKGTFQLEQC
IACHSVMTPGIVRDYKKSAHSRAEPSPTGCDTCHGNNHQKLTMPSSKACGTSECHETQYS
EQGQGGIGSHASCSSFAQVECAWSIERPPGDTAGCTFCHTSPEERCSTCHQRHQFDPKVA
RKSEQCKTCHWGKDHRDWEAYDIGLHGTVYQVNKWDPKQFDWDKKLADADYVGPTCQYCH
MRGGHHNVQRFSTVYASMGMSMADRGAPIWKEKRDRWASVCDDCHSPRFAKENLQAMDES
VKDAGLKYRETFKIAADLVKDGVADPMPKDLCPDWSGQHIWSLKIGAYHDDPAFGGKAGE
SGEFRMSNCTDIERLCFESVGYFQTYIYKGMAHGSWNDATYSDGSFGMDRWLVNVKQDAS
QARRLAALEKKVGITWVPESFWKTGEWLDQLTGPYIVKNHPGKTIFDLCPDPGWLDTHHA
PAEEVEYINRKIKELGWAAGFEHKLEHHDSGHDPAARSQRLSPHE
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgggtaaatttttgaaagtaacattagcgtcggttataggttttggtgccatgggtgtg
gcagccagcctgatgacaaaagaggtaaaggccgtagaaattatcactcactgggtaccg
cacgaagtatatggacagataggcgaaccggataacaacggtaaggtgtttttctctggt
ttaggtgcaaaatatatgggatatcctaaggactcaggtgcaccgccttatccagggaaa
tacagcaaattctggaagacgttgcctgcataccgttattacattcctgactatatgtac
aacagggatgaggtaaggccttcgaacccgattaagggtacgttccagttagagcagtgt
attgcctgtcactcagttatgacccctggcattgtaagggattataagaagagtgcgcat
tcaagggcagaaccgagcccaacgggttgtgatacctgtcatggcaacaatcaccagaag
ttgaccatgccgtcgtcgaaggcttgcggtacaagcgagtgccacgagacgcagtattcg
gagcagggtcagggaggtatcggttcacatgcatcctgttcaagctttgcgcaggtagaa
tgtgcatggtcaattgaaagaccgccgggagacacggctggttgtacgttctgtcacacc
agtccggaagaaaggtgcagcacttgtcaccagaggcatcagtttgatccgaaggttgca
aggaagtcagaacagtgcaagacatgtcactggggtaaagaccatagggattgggaggca
tatgatattggtcttcatggtacggtataccaggtgaacaagtgggaccccaagcagttt
gactgggataagaagttggccgatgcagattatgtaggcccgacctgccagtattgccac
atgaggggcggtcatcataacgtgcagaggtttagcacggtgtatgccagtatgggtatg
tcgatggccgatcgtggagcgccgatatggaaagagaagagagatcgttgggcatcggtg
tgcgatgattgtcattcaccaagatttgcgaaggagaacctgcaggcaatggatgaatcg
gttaaggatgccggtttgaagtatcgtgagaccttcaagatagccgcagaccttgttaag
gatggtgttgctgatcccatgccaaaagatttgtgtcctgactggtcaggtcagcatatc
tggagtttgaagataggcgcatatcatgatgatccggcatttggtggtaaggctggtgag
tcaggtgagttcaggatgtcgaactgcacggatattgaaaggttgtgctttgagagcgtt
ggatatttccagacatacatctacaaaggtatggcgcatggttcatggaacgatgctaca
tactctgatggttcgttcggtatggatcgttggttggtcaacgtgaagcaggacgcttct
caggcaaggagacttgccgcccttgagaagaaggttggcattacctgggttccggagagt
ttctggaagacgggcgaatggcttgatcagttgacgggtccgtacatcgtgaagaatcac
cctggaaagacgatattcgatctgtgtcctgacccaggttggttagatacgcaccatgca
cctgctgaggaagttgagtacatcaacaggaagataaaagaactcggctgggcggccggt
tttgagcataaacttgaacaccatgattcgggacatgatcctgcagcaaggtcgcagaga
ttatcaccacacgaataa

DBGET integrated database retrieval system