Burkholderia plantarii ATCC 43733: bpln_2g17690 Help Entry bpln_2g17690      CDS       T04139                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism bpla  Burkholderia plantarii ATCC 43733 Pathway bpla00261   Monobactam biosynthesis bpla01100   Metabolic pathways bpla01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpla00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     bpln_2g17690  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bpla01008]     bpln_2g17690 Polyketide biosynthesis proteins [BR:bpla01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     bpln_2g17690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ALK33987 LinkDB All DBs Position 2:complement(2268123..2268350) Genome browser AA seq 75 aa AA seqDB search MSWGDENTTYRVVVNHEEQYSIWPEFRELPPGWTAAGKSGTKEACLEWIKEVWTDMRPLS LRKAMAEQEAKRSAN NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgagctggggcgacgaaaacacgacgtatcgggtggtggtcaatcacgaggaacagtat tcgatctggccggagttccgcgagcttccgccgggctggacggccgccggcaagtcgggc acgaaagaggcctgcctcgagtggatcaaggaggtctggaccgacatgcgtccgctgagc ctgcgcaaggccatggcggagcaggaagccaagcgctcggcgaactga

DBGET integrated database retrieval system