Butyrate-producing bacterium SM4/1: CL3_05780 Help Entry CL3_05780         CDS       T02610                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bprm  Butyrate-producing bacterium SM4/1 Pathway bprm01100   Metabolic pathways bprm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bprm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CL3_05780   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CL3_05780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5783 Motif Other DBs NCBI-ProteinID:  CBL35707 UniProt:  D4MPM1 LinkDB All DBs Position 521365..521595 Genome browser AA seq 76 aa AA seqDB search MEFEKLQSIIAEVLNAEPEEIKASASFVDDLGADSLDIFQIVMGIEEEFDIEIPADAAER IATVGDAAQQIRNALN NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggaatttgaaaaattgcagagcattatcgccgaagtgctgaatgcagagcctgaggag attaaagcttccgcttcgtttgtggatgacctgggagcggattccctggacatttttcag attgtgatggggattgaggaggagtttgacatcgagatccccgcagatgcggcagagaga attgccacagtgggagatgcggcgcagcagattcggaatgcgttaaattaa

DBGET integrated database retrieval system