KEGG   Bordetella petrii: Bpet0310
Entry
Bpet0310          CDS       T00637                                 
Name
(GenBank) putative secreted Dienelactone hydrolase
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00364  Fluorobenzoate degradation
bpt00623  Toluene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Bpet0310
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet0310
   00623 Toluene degradation
    Bpet0310
Enzymes [BR:bpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Bpet0310
SSDB
Motif
Pfam: DLH Abhydrolase_1 Peptidase_S9 Hydrolase_4 Chlorophyllase2 Chlorophyllase
Other DBs
NCBI-ProteinID: CAP40642
UniProt: A9HY02
LinkDB
Position
345765..346691
AA seq 308 aa
MHNGFRPRAGGPSRRPAMSRDSQFDSLLPPLRLDRRAFVATALATGFTAATGHAAAATAI
TTPSAGLDAGPVQIPVAGGSMPAYRAAPQGAKALPTVLVVNEIFGVHEYIQDVCRRLAKA
GYLAVAPELFARQGDASKYTEVAKLVAEVVNKVPDDQVMADLDATAAWAAQHGGDPKRLM
VTGFCWGGRIVWLYAAHNPHLRAGAAWYGHVRNTTSPIKPADPIQLVDRLAAPVLGLYGA
ADAGISVADVEQMREALGKGPEAARKSEIRLYKDAPHGFHADYRPSYRKEAAEDAWRRML
DWFERYGG
NT seq 927 nt   +upstreamnt  +downstreamnt
atgcataatggtttccggccgcgcgcgggcggcccctcaaggagacctgccatgtcccga
gattcgcagttcgacagcctgctgccgcccttgcggctggacaggcgcgcattcgtggcc
actgctctggccacgggtttcaccgccgccaccggccatgcggccgcggccaccgccatc
accacgccatcggccggcctcgatgccgggccggtacagatccctgtggcgggcggcagc
atgccggcctatcgcgccgcgccgcagggcgccaaggcgctgcccaccgtgctggtcgtg
aacgaaatcttcggcgtgcacgaatacatacaggacgtgtgccgccggctggccaaggcg
ggctacctggccgtggcgcccgagctcttcgcgcgccagggcgacgcgtccaagtacacc
gaggtcgccaagctggtggccgaggtggtcaacaaggtgcccgacgatcaggtcatggcc
gatctcgacgccaccgcagcctgggccgcccagcatggcggcgacccgaagcggctgatg
gtcactggtttctgctggggcgggcgcattgtgtggctgtacgcggcgcacaatccgcat
ctacgcgccggcgccgcctggtacgggcacgtgcgcaacacgaccagccccatcaagccg
gcggatccgatccagctggtcgaccggctggccgcgccggtactcggcctttatggcgcg
gcggacgccggcatctcggtggccgacgtcgagcaaatgcgcgaagcgctgggcaagggc
ccggaagccgcccggaagtcggaaattcgcctgtacaaagacgcgccccacggctttcat
gccgactaccggcccagctaccgcaaagaggctgccgaagacgcctggcgccgcatgctc
gactggttcgagcgctacggcggataa

KEGG   Bordetella petrii: Bpet1537
Entry
Bpet1537          CDS       T00637                                 
Name
(GenBank) probable carboxymethylenebutenolidase
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00364  Fluorobenzoate degradation
bpt00623  Toluene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Bpet1537
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet1537
   00623 Toluene degradation
    Bpet1537
Enzymes [BR:bpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Bpet1537
SSDB
Motif
Pfam: DLH Hydrolase_4 BAAT_C Abhydrolase_1 Peptidase_S15 Abhydrolase_11 FSH1 BD-FAE Abhydrolase_6
Other DBs
NCBI-ProteinID: CAP41876
UniProt: A9IG93
LinkDB
Position
1584809..1585519
AA seq 236 aa
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQEIFGVNAFMRETVSWLVDQGYAAVC
PDLYARQAPGTALDPQDEAQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLV
GYCLGGALAFLVAAKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQ
LITEGFGANPLLQVHWYEEAGHSFARTSSSGYVASAAALANERTLDFLAPLQSKKP
NT seq 711 nt   +upstreamnt  +downstreamnt
atgttgactgaagggatatcgattcaatcgtatgacgggcatacattcggcgcgctcgtg
ggctcgccggccaaagcgcccgctcccgtgattgtgatcgctcaagaaatatttggtgtg
aacgcgttcatgcgagaaacggtgtcatggctggtcgaccaggggtatgcggcagtttgc
cctgatctgtacgcgcgccaggcgccaggtacagcactcgatccgcaggatgaggcgcag
agagagcaagcctacaagctctggcaggccttcgacatggaggccggcgtgggcgatctg
gaggctgctatccgctatgcgcgacaccaaccctacagcaacggcaaggtgggattggtg
gggtattgcctgggcggtgcgcttgcctttctagtggccgccaaaggatacgtggatcgc
gccgtaggctactacggtgttggactggagaagcagctcaacaaggtcccggaagtcaag
catccggcgttgtttcacatgggcggccaagaccacttcgtgcccgcgccaagccgccag
ctgattactgaaggcttcggtgccaatccattgctgcaagtgcactggtacgaagaggcc
ggacactcgttcgccaggacgagcagttcgggctatgtggcgagtgccgcggcgttggcc
aacgaacgtacactggatttcctggcgcccttgcagagcaagaagccatga

KEGG   Bordetella petrii: Bpet3124
Entry
Bpet3124          CDS       T00637                                 
Name
(GenBank) Putative carboxymethylenebutenolidase
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00364  Fluorobenzoate degradation
bpt00623  Toluene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Bpet3124
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet3124
   00623 Toluene degradation
    Bpet3124
Enzymes [BR:bpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Bpet3124
SSDB
Motif
Pfam: DLH Peptidase_S9 Abhydrolase_1 Peptidase_S15 Chlorophyllase Chlorophyllase2 AXE1
Other DBs
NCBI-ProteinID: CAP43466
UniProt: A9ITU6
LinkDB
Position
complement(3281637..3282428)
AA seq 263 aa
MSFAPAAGQPAATAIHTDTEGLAHGDFDLPVHDGAIAAYYAAPQGKTGLPVVLVVQEIFG
VHEHIKDLCRRLAKAGYLAIAPELYQRQGDAAAYTDVPKLIQEIVAKVPDEQVYADLDAC
LEWAAQHGGDTARAGITGFCWGGRLTWMYAAHNPAIKAGVAWYGKLSAGHGPLIKKVVLD
VAGDLHAPVLGLYGAKDASIPLADVEALKAKLAQGNAAARASEIVVYPEAGHGFLADYRP
MYCEAEARDGWQRMLAWFQRYLG
NT seq 792 nt   +upstreamnt  +downstreamnt
atgagttttgcccccgccgcaggccagcccgccgccaccgctatccacaccgacaccgaa
ggcctggcccacggcgatttcgacctgcccgtgcacgatggcgccattgccgcgtattat
gcggcgccgcaaggcaagacggggctgcccgtggtgctggtggtgcaggaaatcttcggc
gtgcacgagcatatcaaggacctctgccgtcgcctggctaaagccggctacctggcgatc
gcgcccgagctgtatcaacgtcagggcgatgccgccgcctataccgacgtgcccaagctg
atccaggaaatcgtagccaaggtgcccgacgagcaggtctatgccgacctcgacgcgtgc
ctggagtgggccgcgcagcatggcggagacaccgcccgcgccggcatcaccggtttctgc
tggggcggccgcctgacctggatgtacgctgcccacaaccctgccatcaaggccggcgtg
gcctggtacggcaagctcagcgccgggcatggcccgctcatcaagaaggtggtgctggat
gtcgcgggcgacctgcacgcgccggtactgggcctgtacggcgcgaaggacgccagcatt
ccgctggccgatgtggaagccttgaaggccaagctggcccaaggcaacgccgcggcgcgc
gcttccgaaatcgtggtctacccggaggccggacacggcttcctggccgattaccgtccc
atgtattgcgaggccgaggcccgcgacggctggcagcgcatgctggcctggttccagcgc
tacctgggctga

KEGG   Bordetella petrii: Bpet3735
Entry
Bpet3735          CDS       T00637                                 
Name
(GenBank) carboxymethylenebutenolidase
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00364  Fluorobenzoate degradation
bpt00623  Toluene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Bpet3735
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet3735
   00623 Toluene degradation
    Bpet3735
Enzymes [BR:bpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Bpet3735
SSDB
Motif
Pfam: DLH Abhydrolase_6 Hydrolase_4 Peptidase_S9
Other DBs
NCBI-ProteinID: CAP44078
UniProt: A9I2N0
LinkDB
Position
3944228..3944929
AA seq 233 aa
MTHFNFSVPTTHGLMDAYISSQPGPSRPGILLLPEIFGINGAMRLAADQFARANFTVLAP
DLFSQIEPRLELGYTDQDRNRAIAIWQKMDDAVALTDSRAAIKALASDPRCNGQVSVVGF
CLGGKYALQLAAEGGVRSSVSFYPVRVTDYQDRLAGLSCPTQVHVGDDDAHIPPPVQKLL
AERLSGSKIHEFHLYPGAGHGFFNSVRTFGYSPGAAGSAFERAVDFLNRNSGA
NT seq 702 nt   +upstreamnt  +downstreamnt
atgacgcatttcaatttctccgtcccgaccactcatggcctcatggatgcctacatttcc
tctcagccggggccctcacgaccagggatcttgcttcttccggaaatctttggcatcaac
ggcgcgatgcgcttggcggcggaccagttcgcgcgagcaaacttcacggtgctggcacct
gacttgttcagccagatcgaaccgcggcttgaactcggctacacggaccaggatcggaat
cgagcaatcgcgatttggcaaaaaatggacgacgccgttgcgctaaccgacagccgcgct
gcaatcaaggcactggcctctgatccgcgctgcaatggacaagttagcgttgtaggcttc
tgcctgggcggcaagtacgcgctgcagctggcagccgaaggcggcgtgcgttccagcgtc
tcgttctatcctgtacgcgtaaccgactaccaggacaggcttgccgggctttcctgtccg
acgcaggtacatgtcggcgacgacgacgcccatatcccgccccccgtgcagaaattgcta
gccgaaaggctttcggggagcaagatccacgaatttcacctttatccgggtgccgggcac
ggctttttcaactcggtacgcaccttcggctattcgccgggcgccgcggggtcggcattc
gagcgtgccgtagacttcctgaatcgaaacagtggtgcctga

KEGG   Bordetella petrii: Bpet3751
Entry
Bpet3751          CDS       T00637                                 
Name
(GenBank) probable carboxymethylenebutenolidase
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00364  Fluorobenzoate degradation
bpt00623  Toluene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Bpet3751
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet3751
   00623 Toluene degradation
    Bpet3751
Enzymes [BR:bpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Bpet3751
SSDB
Motif
Pfam: DLH Abhydrolase_6 Thioesterase FSH1 Peptidase_S15 Abhydrolase_11 Chlorophyllase Abhydrolase_1
Other DBs
NCBI-ProteinID: CAP44094
UniProt: A9I2T4
LinkDB
Position
3960579..3961295
AA seq 238 aa
MLTEGLSIDAKGGGRFGAHLQLPARGRGPVVIVAQEIFGVNPFMTEVLAWLASEGFVGLC
PDLYWRHGPGIEFDPNDEVQRARALGMFRDYKLEDGVADLRATVAYAASQPFCDGGVAVI
GYCLGGALAYEVAAEGFAQCCVGYYGVGFEKRLERARLVKTPSMFHMGTNDHFVTAEARQ
LITNAFEANPAIALHWYDAGHSFARASSPNFSPEATRTANARTLEMLKRMKPIGTIGQ
NT seq 717 nt   +upstreamnt  +downstreamnt
atgctgactgaaggcttatctatcgatgcgaaaggaggcggccgcttcggcgcgcacctg
caattgccggcacgcgggcgcggcccggtggtgatcgttgcgcaggagatttttggggtc
aacccattcatgaccgaagtcttggcgtggttggcatcagaaggttttgtgggcctctgt
cctgatctgtattggcgccacggaccaggcatcgagttcgatccgaacgacgaagtacaa
cgtgcgcgcgcgctcgggatgttccgcgactacaagctggaagatggggtggcggatttg
cgggccacagtcgcctacgcggcttctcagccgttttgcgacggcggggtcgcggtgatc
ggctattgcctgggcggagcgctggcctacgaagttgccgcagagggattcgcgcaatgc
tgtgtcggctactacggcgtcggcttcgagaagcgtctcgaacgcgcccgacttgtgaag
acaccatcaatgttccacatgggcacgaacgaccatttcgtgaccgcggaggccagacaa
ctcatcacgaatgcctttgaagcgaatcccgcgattgcgctgcattggtacgacgccggg
cactcgttcgcgcgggcttccagcccgaacttctcaccggaggccacgaggacggcgaat
gcacgcacgctggaaatgctgaagcgcatgaagcccatcgggacaattggccaatga

DBGET integrated database retrieval system