KEGG   Bordetella petrii: Bpet1401
Entry
Bpet1401          CDS       T00637                                 
Symbol
catB1
Name
(GenBank) chloromuconate cycloisomerase
  KO
K01856  muconate cycloisomerase [EC:5.5.1.1]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00362  Benzoate degradation
bpt00364  Fluorobenzoate degradation
bpt00623  Toluene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
bpt01220  Degradation of aromatic compounds
Module
bpt_M00568  Catechol ortho-cleavage, catechol => 3-oxoadipate
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpet1401 (catB1)
   00364 Fluorobenzoate degradation
    Bpet1401 (catB1)
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet1401 (catB1)
   00623 Toluene degradation
    Bpet1401 (catB1)
Enzymes [BR:bpt01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.1  muconate cycloisomerase
     Bpet1401 (catB1)
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N
Other DBs
NCBI-ProteinID: CAP41736
UniProt: A9IEE4
LinkDB
Position
complement(1460977..1462197)
AA seq 406 aa
MAWRPIGAMENTQRFQVCAAPALIERVETFLLDLPTIRPHQLSMVTMNGQTLMIVRLYCS
DGTVGVGEGTTIGGLAYGAESPEGMQLAIDTYFAPLLIGADASHVPAIMARLNKAIHDNR
FAKCAVETALFDALGQRTGLPVSQLLGGRVRDSLPVAWTLASGDTAKDIDEAERMLAQRR
HNIFKLKIGRRAVDADVAHVAAIKKALGNRGAVRVDVNMAWSELEAQRGLAGLVDAGCEL
VEQPVACADAMARLKGRFAIAVMADESLTGPASAFALARVAGADVFAVKTEQSGGLRAAQ
QVAAIADAAGIELYGGTMLEGAIGTIASAHAFASFRDLQWGTELFGPLLLTEEILAQPLQ
YTDFQLAVPTGPGLGIALDEDRVQFFRRDRKQGAVVAAAQPVATFN
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcttggcgtccaatcggggccatggaaaacacacaacgctttcaagtttgcgcggct
ccggcgctcatcgagcgggtggagaccttcttattggatctgcctacgatccgtccccat
cagttgtcgatggtgacgatgaacggccagacgctgatgatcgtgcgcctctactgctcg
gacggcacagtgggggtgggcgaagggacgacgatcggcgggttggcctatggcgccgaa
tcgcccgagggcatgcagctggccatcgatacctatttcgcgcccctgctgatcggcgcg
gatgccagccacgtgcccgccatcatggccaggctcaacaaggccatccacgacaaccgc
ttcgccaagtgcgctgtggagaccgcgctgttcgacgcgctggggcagcgcacgggtctg
ccggtgtcccaactgctgggcggccgggtgcgcgacagcctgccggtggcctggacgctg
gcttcgggcgatacggccaaggatattgacgaggccgagcgcatgctggcgcagcgccgc
cacaacattttcaagctcaagatcggccgccgcgccgtggatgccgacgtagcccacgtc
gccgccatcaagaaagcactgggcaatcgcggcgccgtgcgggtggacgtgaacatggcc
tggagcgaactcgaagcccagcgcggcttggccgggctggtcgacgcgggatgcgagctg
gtggaacagcccgtggcctgtgccgacgcaatggcgcgcctgaaaggccgctttgcgatt
gccgtgatggccgacgaatcgctgacgggtccagcctcggcattcgccctggcgcgtgtc
gccggtgccgacgtattcgcggtcaaaaccgaacagtccggcggcctgcgggcagcccag
caggtggcggcgatcgccgacgcagcgggcatcgaactctatggcggaaccatgttggag
ggcgcgatcggcacgatcgcctcggcgcatgcattcgctagcttccgcgatctgcaatgg
ggtaccgaactgttcggccccttgttgctgaccgaagaaatcctggcccagcccctgcag
tacacggacttccagctcgcagtgccgacggggccgggcctgggcatcgcactggatgaa
gaccgcgtccagttcttccgccgcgacaggaagcagggcgccgtcgtggcggcagcccag
cccgtcgcgaccttcaattga

KEGG   Bordetella petrii: Bpet3349
Entry
Bpet3349          CDS       T00637                                 
Symbol
catB3
Name
(GenBank) chloromuconate cycloisomerase
  KO
K01856  muconate cycloisomerase [EC:5.5.1.1]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00362  Benzoate degradation
bpt00364  Fluorobenzoate degradation
bpt00623  Toluene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
bpt01220  Degradation of aromatic compounds
Module
bpt_M00568  Catechol ortho-cleavage, catechol => 3-oxoadipate
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpet3349 (catB3)
   00364 Fluorobenzoate degradation
    Bpet3349 (catB3)
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet3349 (catB3)
   00623 Toluene degradation
    Bpet3349 (catB3)
Enzymes [BR:bpt01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.1  muconate cycloisomerase
     Bpet3349 (catB3)
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Other DBs
NCBI-ProteinID: CAP43691
UniProt: A9HX10
LinkDB
Position
3518342..3519484
AA seq 380 aa
MESIRIETVEAILVDLPTIRAHQLAMAVMQRQTLVIVRLRCSDGVEGLGEATTIGGLSYG
EESPEGIKLAIDTYLAPALVGQDATNARAALARLEKVARGNRFAKSALETALLDAQGKRL
DVPVATLLGGAVRSRLPVLWTLASGDTARDIDEAEALLQSRRHNTFKLKIGRRDVASDVA
HVSRIKQALGDRARVTVDVNQAWDEAEAAGAIARLEAAGVDLIEQPIPRANLAGMARLAA
RFVVPIMADEAVCTPEDALDIARLGAADVLALKIAKSGGILEMGRTAAVGDAAGMALYGG
TMLEGSIGSVASAHGFATLPRLAWGTELFGPLLLKDDIVAVRPVYDDFSLELPAGPGLGL
ALDEDKLAFYRRDRAAARGA
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggaaagcattcgcatcgaaaccgtcgaagccattctggtggatctgcccaccatccgc
gcccaccaactggccatggccgtcatgcagcgccagacactggtgatcgtgcgcctgcgc
tgcagcgacggtgtcgaagggctgggcgaggcgacgaccataggcggcctgagctacggc
gaagaaagccccgaaggcatcaagctggccatcgacacgtacctggcgccggccctggtc
gggcaggacgccaccaacgcgcgcgcggccctggcgcggctggaaaaggtggcgcgcggc
aaccgtttcgccaagtcggcgctggaaacggccctgctcgacgcccagggcaagcgcctg
gacgtgcccgtggccaccctgctgggcggcgcggtgcgctctcggctgcccgtgctgtgg
accctggccagcggcgatacggcgcgcgacatcgacgaggccgaggcgctgctgcaatcc
cgccggcacaacacgttcaagctgaaaatcggccggcgcgacgtggcgagcgacgtggcc
catgtatcgcgcatcaagcaagccctgggcgaccgcgcccgggtgacggtggacgttaac
caggcctgggacgaggccgaggcggccggcgccatcgcgcggctggaagccgccggcgtt
gacctgatcgaacaacctattccgcgcgccaacctggccggcatggcgcggctggcggcc
cgcttcgtggtgcccatcatggccgacgaagccgtgtgcacgccggaagacgcgctggac
atcgcgcgcctgggcgcggccgacgtgctggcgctgaaaatcgccaagtcgggcggcatc
ctggaaatgggacgcaccgcggccgtgggcgacgccgcgggcatggcgctgtacggcggc
accatgctcgaaggctcgatcggctctgttgcatcggcgcacggttttgcgacgctgcca
cgcctggcgtggggcaccgagctgttcgggccgctgctgttgaaagacgacatcgtggcg
gttcgcccggtgtacgacgacttttcgctggaactgccggccgggcccggactgggcctg
gcgctggacgaggacaagctggcgttttaccggcgcgaccgcgccgcggcacgcggcgct
tga

KEGG   Bordetella petrii: Bpet3734
Entry
Bpet3734          CDS       T00637                                 
Symbol
catB4
Name
(GenBank) muconate cycloisomerase
  KO
K01856  muconate cycloisomerase [EC:5.5.1.1]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00362  Benzoate degradation
bpt00364  Fluorobenzoate degradation
bpt00623  Toluene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
bpt01220  Degradation of aromatic compounds
Module
bpt_M00568  Catechol ortho-cleavage, catechol => 3-oxoadipate
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpet3734 (catB4)
   00364 Fluorobenzoate degradation
    Bpet3734 (catB4)
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet3734 (catB4)
   00623 Toluene degradation
    Bpet3734 (catB4)
Enzymes [BR:bpt01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.1  muconate cycloisomerase
     Bpet3734 (catB4)
SSDB
Motif
Pfam: MR_MLE_C MAAL_C
Other DBs
NCBI-ProteinID: CAP44077
UniProt: A9I2M6
LinkDB
Position
3943566..3944231
AA seq 221 aa
MLEARRHKTFKIKMGFGGAETETRRVVRTARAIHQLAPEAIVTVDLNQAWDMTTCMRLLP
QMDDAGIAMVEQPLPFWNKDGMAALCSRLRMAVVADEGLWDLHDAYAAFKSGATALYGVK
IGKGGGIRRAYKAASVAEAAGIPIYGGMALESSIGTAAALQLFSALPLLSWDCELIGPLL
LADDLAVQPTQYHNFEVVVPHGTGLGVEPDHDKVNFYTRKT
NT seq 666 nt   +upstreamnt  +downstreamnt
atgctagaagcgcgacgccacaagaccttcaagatcaagatgggattcggaggcgccgag
accgaaacgcgacgcgtcgtccggacggcgcgagcgattcatcagcttgctccggaagca
atagtgactgtggacctgaaccaggcttgggacatgaccacgtgcatgcgattgctgccg
caaatggacgatgctggcatcgcaatggtcgaacagcctttgcccttctggaacaaggat
gggatggccgcgctttgctctcgtcttcggatggccgtggtcgcggacgaaggcctgtgg
gacttgcacgatgcctacgccgccttcaagtccggggccactgcactgtacggtgtgaaa
atcggcaagggtggtggcattcgccgcgcctataaggcggcttcggtcgccgaagcggcc
ggcattcccatctacggcggcatggcgctggaaagctccatcgggactgcggcggcgctg
cagctgttcagcgcactcccgttactttcctgggattgcgaactcatcggtcccctgctt
ttggccgacgatctcgctgtgcagccaacgcagtaccacaacttcgaagtcgtagttccc
cacggcacgggcctgggcgtcgaacccgatcatgacaaagtcaacttttacacacgcaag
acatga

DBGET integrated database retrieval system