KEGG   Bordetella petrii: Bpet1538
Entry
Bpet1538          CDS       T00637                                 
Name
(GenBank) maleylacetate reductase
  KO
K00217  maleylacetate reductase [EC:1.3.1.32]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00362  Benzoate degradation
bpt00364  Fluorobenzoate degradation
bpt00623  Toluene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
bpt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpet1538
   00364 Fluorobenzoate degradation
    Bpet1538
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet1538
   00623 Toluene degradation
    Bpet1538
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.32  maleylacetate reductase
     Bpet1538
SSDB
Motif
Pfam: Fe-ADH Fe-ADH_2 AIRC
Other DBs
NCBI-ProteinID: CAP41877
UniProt: A9IG95
LinkDB
Position
1585516..1586574
AA seq 352 aa
MNFIHDYRSPRVIFGPDSLARLPQELERLGIDRALVLTTPEQAPLGRQVAEPVIGHVAAF
YDGATMHVPALVAEEACKIARTSEANGVIAIGGGSTIGLAKIVALRTELPIVAVPTTYAG
SEMTSIFGITEGGVKKTGRDARVMPRAVIYEPRLTLELPLSISVTSAINAIAHAVEGLYA
PDATPLLTIMAQEGIAATVRAISRMYQSPRDLQARGDALYGAWLCASVLGNVSMALHHKL
CHTLGGTLDLPHAQTHTVVLPHALAYNARAVPDAMRVLRIALGHDDPPTALYELARDNGA
PVALRDLGMREEDIEHVGDLALQDRYPNPRELDRDALLALLRDAYHGRPPSA
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgaatttcattcacgactatcgttccccgcgggtgatttttggacccgacagcctcgcc
cgattgccgcaggaactggaacgtctcggcattgaccgggcgctcgtgttgaccacgcct
gagcaggcgcccctgggacggcaagtagccgagccggtcatcggccacgtggcagccttc
tacgatggtgcgaccatgcatgtacccgctttggtggctgaggaggcctgcaagattgcg
cgcacgagtgaggctaatggcgtcattgcgattggtgggggatctactatcggactcgct
aagatcgtggcgctccgtacagagttgcccatcgtcgctgtgcccacgacatatgcaggt
agcgagatgacgtccatcttcggtatcacagagggtggcgtcaagaaaaccggccgcgac
gcgcgtgtcatgccccgtgcagttatctacgagccccggctgaccctagagctacccctt
agcatcagcgtgaccagcgcgatcaatgcaatagcccatgcagttgaaggcctgtatgcg
ccagatgccacgccgctgcttaccatcatggcccaggaaggaatcgcagcgacggtacgc
gcgatttccagaatgtatcaatcaccaagagatcttcaggctcgcggcgacgcgctttat
ggcgcttggctctgcgcgagcgtgcttggcaacgtcagtatggcattgcaccacaagctg
tgccacacgctgggaggaacgctcgatctccctcatgcccagacccatacggtcgtgctg
ccccacgcgctggcctataacgcgcgcgcggtgccagacgcaatgcgtgtgctgcgcatt
gccctggggcatgacgatccacccacggccttgtacgaattggctcgcgacaatggcgca
cccgtggccttgcgcgatctcggaatgcgcgaggaggatattgagcatgttggcgacctg
gcattgcaggaccgctatcccaatccgcgggaactggatcgagacgcattgcttgcattg
ctgcgcgatgcgtaccacggacgcccgccttccgcttga

KEGG   Bordetella petrii: Bpet3730
Entry
Bpet3730          CDS       T00637                                 
Name
(GenBank) maleylacetate reductase
  KO
K00217  maleylacetate reductase [EC:1.3.1.32]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00362  Benzoate degradation
bpt00364  Fluorobenzoate degradation
bpt00623  Toluene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
bpt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpet3730
   00364 Fluorobenzoate degradation
    Bpet3730
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet3730
   00623 Toluene degradation
    Bpet3730
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.32  maleylacetate reductase
     Bpet3730
SSDB
Motif
Pfam: Fe-ADH Fe-ADH_2
Other DBs
NCBI-ProteinID: CAP44073
UniProt: A9I2L3
LinkDB
Position
3940343..3941416
AA seq 357 aa
MLNFTYQSLPARVRFGRGTIAELGGELEKLGCDKVILVTSAPQSEDADRLREQIGGACAG
VFKRAAMHTPTDVTQEALAEVVRLGADGVVAIGGGSAIGLSKAIALHTDLPQLVIPTTYA
GSEMTPIIGQTENGVKTTQRTLKVLPEAVIYDVDLTFSLPVGMSVSSGINAMAHAVEALY
ATDTNPVVAQMAEAGIAALYRSLPALRSGASDPAIRGEALYGSWLSAICLASTSMGLHHK
LCHTLGGALNLPHAETHTIVLPHAIAYNAPNVRDAVEAIKRAMGGGGIAGRIYDIALDSG
VPVSLREVGMRECDIEKVTDLVMSRPYANPRPLDATLIRRLLANAWSGLRPDHSTYL
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgctgaacttcacctatcaatccctcccggcccgcgtcaggttcggccgtggcaccatt
gccgaactggggggcgaactggaaaaactcggctgcgacaaagtcattttggtcaccagt
gcgccacagtccgaagatgcggacaggctacgtgagcagattggcggtgcttgcgccggc
gtgttcaaacgcgctgcaatgcacactccgacggatgtaacccaggaggcgctagccgaa
gtggtccggctgggcgccgacggtgtcgtcgctatcggcggcggttcagcaattgggctg
tccaaagcgatcgcgttacatacggatctgccccaactggtgattcccaccacttatgcg
ggatcggaaatgacgccaatcatcggccagaccgaaaatggcgtgaagacgacgcagcgc
acgcttaaggttctgcccgaggccgtcatctacgacgtggacttgaccttttccctacct
gtaggcatgtcggtctccagcggcatcaatgcgatggcgcatgcagtagaggcgctctat
gccacggacacaaatccagtggtagcacagatggccgaagccggcatagccgccctatac
cgtagcctgccggcgcttcgcagcggcgccagcgatccggcgatacgtggtgaagcgctc
tacggttcatggctgagcgctatctgcctcgcgtccacttcaatggggctacaccacaag
ctctgtcacacgctcggcggcgcgctcaaccttcctcatgcggaaacgcacactatcgtc
ctgccgcacgcaatagcctataacgcaccgaacgtgcgtgacgccgtggaggcgatcaag
cgcgccatgggcggcggcggcattgccggtcgcatttacgacatcgccctggacagcggg
gttccagtctccttgcgcgaggtagggatgcgggaatgcgatatcgaaaaggtcaccgac
ctggtgatgtccaggccgtacgccaacccgcgcccgctcgacgccacgctgatccgcagg
ttgctcgccaatgcctggtcggggttgcggcctgaccattcgacttacctttaa

KEGG   Bordetella petrii: Bpet3752
Entry
Bpet3752          CDS       T00637                                 
Name
(GenBank) maleylacetate reductase
  KO
K00217  maleylacetate reductase [EC:1.3.1.32]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00362  Benzoate degradation
bpt00364  Fluorobenzoate degradation
bpt00623  Toluene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
bpt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpet3752
   00364 Fluorobenzoate degradation
    Bpet3752
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet3752
   00623 Toluene degradation
    Bpet3752
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.32  maleylacetate reductase
     Bpet3752
SSDB
Motif
Pfam: Fe-ADH Fe-ADH_2 Herpes_US12 AIRC
Other DBs
NCBI-ProteinID: CAP44095
UniProt: A9I2T8
LinkDB
Position
3961292..3962350
AA seq 352 aa
MNFIHDPLTPRVLFGAGRLQSLGEELKLLGIRRVLVISTPEQRELANQVAALIPGSVAGF
FDRATMHVPSQIVDQAASVARELGVDSYVAPGGGSTIGLAKMLALHSSLPIVAIPTTYAG
SEMTSIYGVTENELKKTGRDRRVLARTVIYDPELTFGLPTGISVTSGLNAIAHAVEGLYA
PEVNPILAIMAQQGIAALAKSIPTIRSAPTDLEARSQAQYGAWLCGSVLGNVSMALHHKL
CHTLGGTFNLPHAETHTVVLPHALAYNTPAIPRANAWLQEALATREPAQALFDLAKSNGA
PVSLQSIGMKEADLDRACELVMSAQYPNPRPLEKHAIANLLRRAYLGEPPQP
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgaacttcatccacgacccactcacgcctcgcgtcttgttcggcgcggggcgcctgcag
tctctgggcgaagaactgaagctgctcgggatacggcgcgtgctggttatctccaccccg
gagcagcgtgaactcgccaaccaggtcgcggccctcattcccggcagcgtcgccggattc
ttcgaccgcgcgacgatgcacgtgccgtcgcaaatcgtcgatcaggcggcttctgtcgcg
cgagaactcggcgttgacagctatgtggcccctggcggaggttcaaccatcggcctcgcg
aagatgctcgcgctccactcgtcattgccaatcgtggccatccccacgacgtatgccgga
agcgagatgacatccatctatggcgtcaccgaaaacgaattgaagaagaccggtcgggat
aggcgcgtcctcgcgcgcacggtcatctacgacccggagctgacattcggcctgcccacg
ggcatcagcgtgacaagcggtttgaacgcgatcgcgcacgcggttgagggcctttacgcg
ccggaggtgaacccgatcctcgcgatcatggcccagcaaggaatcgcggcgttggccaaa
tcaattcccacgatccgttcggctccgaccgaccttgaggcccgttcgcaagcgcaatac
ggtgcatggctgtgcggaagtgtgctcggcaatgtcagcatggccctgcaccacaagctg
tgccatacgttggggggaacattcaatctgccgcacgctgaaacgcacactgtcgtgctg
ccgcacgcgctcgcctacaacacgccggccatcccgcgtgcgaatgcatggctgcaggag
gcactcgccactcgcgaaccggcgcaggcactgtttgatctcgcgaagtcgaacggcgcg
ccggtttcactgcaatcgatcgggatgaaggaagcggacttggaccgcgcctgcgagctg
gtgatgtccgcgcaataccccaatccgcgaccgctcgaaaagcatgcgatcgcgaatctg
ctgcgcagggcctatctaggggagccaccgcaaccctga

DBGET integrated database retrieval system