KEGG   Bordetella petrii: Bpet3738
Entry
Bpet3738          CDS       T00637                                 
Name
(GenBank) large terminal subunit of phenylpropionate dioxygenase
  KO
K03268  benzene/toluene/chlorobenzene dioxygenase subunit alpha [EC:1.14.12.3 1.14.12.11 1.14.12.26]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00362  Benzoate degradation
bpt00623  Toluene degradation
bpt00625  Chloroalkane and chloroalkene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
bpt01220  Degradation of aromatic compounds
Module
bpt_M00547  Benzene/toluene degradation, benzene => catechol / toluene => 3-methylcatechol
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpet3738
   00625 Chloroalkane and chloroalkene degradation
    Bpet3738
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet3738
   00623 Toluene degradation
    Bpet3738
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.3  benzene 1,2-dioxygenase
     Bpet3738
    1.14.12.11  toluene dioxygenase
     Bpet3738
    1.14.12.26  chlorobenzene dioxygenase
     Bpet3738
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: CAP44081
UniProt: A9I2P0
LinkDB
Position
3947376..3948905
AA seq 509 aa
MSLEDVAIGCRSSKTKASSVWSTTSSTRRTDLKTEALIDFETAQSPTTHPSTTMKREETM
NHTDTSPIKLRKNWNAREMQALFDERAGRIDPRIYTDEDLYQIELERVFGRSWLLLGHET
QIKKPGDYTTNYMGEDPVLVVRQKDGSIAVFLNQCRHRGMRICRSDAGNAKAFTCSYHGW
AYDTAGNLVNVPFEAESFPCLDKKEWSPLKARVATYKGLIFANWDHDAPDLDTYLGEAKF
YMDHMLDRTEAGTEAIPGVQKWVIPCNWKFAAEQFCSDAYHACTTSHLSGILAGLPDGVE
LADHAPPTVGKQYRAPWGGHGTGFFIGAPNLLLAMMGPKITSYWTEGPASEKAAQRLGSV
ERGSKLMVEHMTVFPTCSFLLGPNTVRTWHPRGPNEVEVWAFTVVDADAPDDIKEEFRRQ
TLRTFSAGGVFEQDDGENWVEIQHILRGHKARSRPFNAEMSMGQTIDDDPVYPGRISNNV
FSDEAARGMYAQWLRMMTSSDWAALNATR
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgtctttggaagatgtggccattgggtgcagatcgagcaaaaccaaggcttcatccgtt
tggtcaacgacttcctcgacacggaggactgatctcaagaccgaagcgctcattgatttc
gaaaccgcgcaatcacccaccacccacccatccaccaccatgaaacgtgaggagacaatg
aatcacaccgacacctcccctatcaagctgcgcaagaactggaacgcccgcgagatgcag
gcgctctttgacgagcgcgccggacgtatcgacccgcgtatctataccgatgaagacctg
taccagatcgaactggagcgcgtcttcggcaggtcgtggcttctgttggggcatgaaacc
cagatcaagaaaccgggcgactacaccacgaactatatgggcgaagaccccgtcttggtc
gtgaggcagaaggacggcagcatcgctgtattcctgaaccaatgccgccaccgcggcatg
cgcatctgccgctcggatgccggcaacgcgaaggctttcacgtgcagctaccacggctgg
gcctacgacacggcgggcaacctggtcaacgtccccttcgaggctgaatccttcccttgc
ctggacaagaaggaatggagccccttgaaggcccgggtcgcgacctacaagggcctgatc
ttcgccaactgggaccacgacgccccggatctggacacctatctgggcgaggcgaagttc
tacatggaccacatgctcgaccgtaccgaggccggcaccgaagccatcccgggtgtgcag
aagtgggtcatcccctgcaactggaaattcgccgccgaacagttctgcagcgacgcgtac
cacgcctgcacgacctcgcatctgtccggcatcctggccggtctgccggacggcgttgag
ctggccgatcacgctccgccgacggtcggcaagcaataccgtgcgccgtggggcggacac
ggaaccggtttctttattggagcacccaatctcctgctcgccatgatggggccgaagatc
accagctactggaccgaaggccccgcctctgaaaaggcggcccagcgcctgggcagcgtc
gaacgcggctccaaactcatggtcgagcacatgactgtgtttcccacgtgctccttcctt
ctaggccccaacacggttcggacatggcatccacgcgggccgaacgaggtggaggtgtgg
gcgttcacggtggtcgacgccgatgctcccgacgacatcaaggaagagttccgccgccag
acgctgcgcaccttctccgctggcggggtgttcgagcaggacgacggggagaactgggtc
gagatccagcacatcctgcgcggccacaaggcacgcagccgaccgttcaacgcggagatg
agcatgggccagaccattgacgacgatccggtctaccccgggcgcatcagcaacaacgtc
ttcagcgatgaagcggcccgcgggatgtatgcccagtggctgcggatgatgacctcgtct
gactgggccgcgctgaacgccacacgctga

KEGG   Bordetella petrii: Bpet3739
Entry
Bpet3739          CDS       T00637                                 
Name
(GenBank) chlorobenzene dioxygenase, small subunit of terminal oxygenase
  KO
K16268  benzene/toluene/chlorobenzene dioxygenase subunit beta [EC:1.14.12.3 1.14.12.11 1.14.12.26]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00362  Benzoate degradation
bpt00623  Toluene degradation
bpt00625  Chloroalkane and chloroalkene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
bpt01220  Degradation of aromatic compounds
Module
bpt_M00547  Benzene/toluene degradation, benzene => catechol / toluene => 3-methylcatechol
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpet3739
   00625 Chloroalkane and chloroalkene degradation
    Bpet3739
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet3739
   00623 Toluene degradation
    Bpet3739
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.3  benzene 1,2-dioxygenase
     Bpet3739
    1.14.12.11  toluene dioxygenase
     Bpet3739
    1.14.12.26  chlorobenzene dioxygenase
     Bpet3739
SSDB
Motif
Pfam: Ring_hydroxyl_B
Other DBs
NCBI-ProteinID: CAP44082
UniProt: A9I2P3
LinkDB
Position
3949015..3949578
AA seq 187 aa
MLDSVKRADVFLRKPAPVAPELQHEIEQFYYWEAKLLNDRRFEEWFALLAADIHYFMPIR
TTRIMRDARLEYSGTGEYAHFDDDAAMMKGRLRKVTSDVSWSENPASRTRHLVSNVMIAD
GPVEGEYEISSAFIVYRNRLERQLDIFAGERRDTLRRNKTETGFEIVNRTILIDQSTILA
NNLSFFF
NT seq 564 nt   +upstreamnt  +downstreamnt
atgcttgattccgtcaagagagccgacgtctttctccgtaaacccgcgccggtggcgccc
gagctgcaacacgaaatcgagcagttctactactgggaagccaagctgctcaacgatcgc
cgctttgaggagtggttcgccctgctggcggctgacatccactacttcatgccgatccgc
accacgcggatcatgcgggacgcacgcctggagtactcgggcaccggcgagtacgcgcac
ttcgacgacgatgccgcgatgatgaaaggccggctgcgcaaggtcacatccgacgtgagc
tggtcggagaaccccgcttcgcgcacccggcacctcgtgagcaacgtgatgatcgccgac
ggaccggtagaaggcgagtacgagatttccagcgctttcatcgtgtatcgcaatcgcctg
gaacggcaactcgacatctttgccggcgaacgtcgcgacacgttgcgccgcaacaagacc
gagaccgggttcgagattgtcaatcggaccatcctgatcgaccagagcaccatcctggcg
aacaacctcagcttcttcttctag

KEGG   Bordetella petrii: Bpet3740
Entry
Bpet3740          CDS       T00637                                 
Name
(GenBank) probable phenylpropionate dioxygenase ferredoxin subunit
  KO
K18089  benzene/toluene/chlorobenzene dioxygenase ferredoxin component
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00362  Benzoate degradation
bpt00623  Toluene degradation
bpt00625  Chloroalkane and chloroalkene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
bpt01220  Degradation of aromatic compounds
Module
bpt_M00547  Benzene/toluene degradation, benzene => catechol / toluene => 3-methylcatechol
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpet3740
   00625 Chloroalkane and chloroalkene degradation
    Bpet3740
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet3740
   00623 Toluene degradation
    Bpet3740
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: CAP44083
UniProt: A9I2P7
LinkDB
Position
3949587..3949910
AA seq 107 aa
MAWTYIMRQSDLPPGEMQRHEGGPEPVMVCNVDGEFFAVQDTCTHGNWALSDGYLDGGVV
ECTLHFGKFCVRTGKVKALPACKPIKVFPIKVEGGDVHVDLDAGEVK
NT seq 324 nt   +upstreamnt  +downstreamnt
atggcttggacgtacatcatgcggcagtccgacctgccgccaggcgagatgcagcgccat
gaaggcggccccgagccggtgatggtctgcaacgtcgacggggagttcttcgccgtgcag
gacacgtgcacgcatggaaactgggcgctatcggatggctatctggacggtggcgtcgtc
gaatgcacgctgcatttcggcaagttctgcgttcgaaccggaaaggtgaaggcgctgcca
gcctgcaagccgatcaaggtgtttcccatcaaagtggaaggcggcgacgtgcatgtcgat
cttgacgccggcgaggtgaagtga

KEGG   Bordetella petrii: Bpet3741
Entry
Bpet3741          CDS       T00637                                 
Name
(GenBank) putative ferredoxin reductase
  KO
K18090  benzene/toluene/chlorobenzene dioxygenase ferredoxin reductase component [EC:1.18.1.3 1.18.1.-]
Organism
bpt  Bordetella petrii
Pathway
bpt00361  Chlorocyclohexane and chlorobenzene degradation
bpt00362  Benzoate degradation
bpt00623  Toluene degradation
bpt00625  Chloroalkane and chloroalkene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
bpt01220  Degradation of aromatic compounds
Module
bpt_M00547  Benzene/toluene degradation, benzene => catechol / toluene => 3-methylcatechol
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpet3741
   00625 Chloroalkane and chloroalkene degradation
    Bpet3741
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bpet3741
   00623 Toluene degradation
    Bpet3741
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     Bpet3741
    1.18.1.-
     Bpet3741
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Reductase_C DAO AlaDh_PNT_C NAD_binding_8 GIDA Pyr_redox_3 Lycopene_cycl FAD_binding_3
Other DBs
NCBI-ProteinID: CAP44084
UniProt: A9I2Q1
LinkDB
Position
3949910..3951142
AA seq 410 aa
MATHVAIIGNGVAGFTTAQALRAEGFEGRISLIGNEPHLPYDRPSLSKAVLGGSLEHPPV
LAEADWYGEARIDMLSGRSVTNLNVDARTISLDDGSTFAADAIVIATGSRARTLALPGSQ
LTGVVTLRTYDDVRPLCRGWTPATRLVIAGGGLIGCEVATTARKLGLAVTILESADELLV
RVLGRRIGAWLRGLLTELGVRVELGTGVAGFSGDDRLEEVLASDGRRFAADNALVCIGAE
PEDQLARQAGLSCDRGVIVDDHGATHAEGVFAVGDAASWPLRDGGRRSLETYMNAQRQAA
AVAAAILGKHGSAPQVPVSWTEIAGHRMQMAGDIEGPGEFVLRGTLGDGAALLFRLRDGR
IQAVVAVDAPRDFAMAARLVEARAAIEPARLADFSNSMRDLVRAQQGDSA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggcgacgcatgtggcgatcatcggcaatggtgtggcgggctttacgaccgcgcaagcc
ctgcgtgctgaaggctttgaggggcggatctcgctgatcgggaacgaaccgcatctgccc
tatgaccgaccgtctctgtccaaggccgtgctcggcggcagtcttgagcatccgcccgta
ttggcggaagccgactggtacggcgaggcgcgcatcgacatgctgtccggccgaagtgtc
accaacctgaacgtggacgctcgaacgatcagcctagacgatggaagcacgttcgctgca
gacgccatagtcatcgccacgggcagccgggcacgaacgcttgcgttgcctggcagccaa
ctgaccggcgttgtcacgcttcgcacctacgacgacgtgcggccgctgtgccgtggctgg
acgcctgcaacgcgactggtgatcgcaggcggcggattgatcggctgcgaagtcgcgacg
acggcgcgcaagctcggcctggcggtgacgattctggaatccgccgacgaactgctggtg
cgtgtgctgggccggcgcatcggcgcctggctgcgcggcctgttgacggaactcggcgta
cgggtcgagctgggaacaggcgtggccggcttctctggcgacgaccggctcgaagaggta
ctggccagcgatggacgccgcttcgccgccgacaacgcgcttgtctgcatcggcgccgag
cccgaggatcaactcgcgcgtcaggcgggcctgtcctgcgaccggggcgtcattgtcgat
gaccacggcgcgacgcatgccgaaggggtattcgcagtcggcgatgcggccagttggccg
ctgcgcgatggcggcaggcgttcgctcgaaacctacatgaacgcgcagcgccaggccgcc
gcggtggcagcggccattctgggaaagcatggatcggcgccgcaggtgcccgtgtcctgg
acggagatcgccgggcatcggatgcagatggcgggcgatatcgaagggccgggcgaattc
gtcttgcgcggcacgctgggggatggcgcggcgctgctgttccggctgcgggacggaagg
attcaggccgtcgtcgcggtcgacgcgccgcgtgacttcgcgatggcggcccgattggtg
gaagcgcgtgcagccatcgagccggcgcggctggcagatttttcaaacagcatgcgcgat
ctcgtgcgtgcacaacaaggagactcagcatga

DBGET integrated database retrieval system