KEGG   Bacillus pumilus SAFR-032: BPUM_1054
Entry
BPUM_1054         CDS       T00599                                 
Name
(GenBank) transcriptional regulator
  KO
K05519  transcriptional activator of comK gene
Organism
bpu  Bacillus pumilus SAFR-032
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bpu03000]
    BPUM_1054
Transcription factors [BR:bpu03000]
 Prokaryotic type
  Other transcription factors
   Others
    BPUM_1054
SSDB
Motif
Pfam: Bmp Peripla_BP_4 PP_kinase_C_1 Glyoxalase
Other DBs
NCBI-ProteinID: ABV61738
UniProt: A8FBX1
LinkDB
Position
1141896..1142858
AA seq 320 aa
MKYQRLVMIFSFLLLLSACSQAPLKGQIEKVGLLVPDTINDQVWGTKGYKGLLNIQSTFG
VDVYYKEGMVDKEKIVDAIEEFHKKGVNLIIGHGSEYSEIFNLISEDYPKTQFITVNGNK
PQADNVANVTFKGEAMGFFGGMTAAHMSKTKKIGILATYDWQSEVDGFIKGAKYQDEHVQ
VLAEFVENWDDADKAVELYQKLKKQGVDVVYPAGDGYNIPVIEQIKADNLSAIGYVTDQS
NLGSHTVLTSTVQHVDKAYSIIAKKFNEGKLNEQGEYSFDFKEGVIEMGKFSSTIDRAFL
KDIESDIATYKKTGKLPNEK
NT seq 963 nt   +upstreamnt  +downstreamnt
atgaagtatcagcggcttgtcatgatcttttcgttccttctcctattatctgcctgctca
caggcacctttaaaaggacagattgagaaggtgggtttactcgtccccgatacaattaat
gatcaagtttggggaacgaaaggttataaaggcttattaaatattcaatcgacatttggt
gtagatgtttattataaggaaggaatggtcgacaaagagaaaatcgttgatgccattgaa
gaatttcacaaaaaaggagtcaatttgattattggccatggcagtgaatacagcgaaatt
ttcaacttaattagtgaagattatccgaaaacacaatttattacggtaaatggaaacaag
cctcaggcggataatgttgcgaatgtgacatttaaaggtgaagcgatgggcttttttgga
ggcatgacagcagcacatatgtcaaaaacaaaaaagattggtattcttgctacatatgat
tggcaaagcgaagtagacggctttatcaaaggtgcaaaatatcaagatgaacatgtacaa
gtgcttgccgagtttgtcgaaaactgggatgatgcggacaaagccgtggagctctatcaa
aaattgaaaaaacagggcgtagatgttgtatatccagcaggtgatggttataatatccct
gtcattgaacaaatcaaagccgataatttatcagcgatcggatatgtcaccgatcaatcc
aacctcggtagccataccgtcttaacaagcaccgttcagcatgtggataaagcgtacagt
attattgcgaagaaatttaatgaaggcaagctaaatgaacaaggtgagtactcctttgac
tttaaagaaggagtgatcgaaatggggaaatttagttccaccattgaccgtgcttttttg
aaagacattgaaagtgatattgcgacttataaaaaaactggcaaactgccaaatgaaaag
tga

DBGET integrated database retrieval system