KEGG   Bacillus pumilus MTCC B6033: BW16_18160
Entry
BW16_18160        CDS       T03175                                 

Definition
(GenBank) bacilysin biosynthesis protein BacA
  KO
K19546  prephenate decarboxylase [EC:4.1.1.100]
Organism
bpum  Bacillus pumilus MTCC B6033
Pathway
bpum00998  Biosynthesis of various secondary metabolites - part 2
bpum01100  Metabolic pathways
bpum01110  Biosynthesis of secondary metabolites
Module
bpum_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bpum00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BW16_18160
Enzymes [BR:bpum01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.100  prephenate decarboxylase
     BW16_18160
SSDB
Motif
Pfam: PDT
Other DBs
NCBI-ProteinID: AHL73221
LinkDB
Position
3434144..3434749
AA seq 201 aa
MILKNDDVFHFKEEPIPSPKMFTVNTLGPKGTSSEYAAKHFISQSTTTLGTHTKLSLYDT
FETCIEHTLSQPLQFTLVPHAYEGIKHFYMRPDLQLLQIFRCDTPMYGLAVRPDFPFNEQ
MLHHLKIVSHPAPVNLIQYFIHQNAEFELVNSTSTAAQKVRDGEFDFALTNEVARATYGL
IFIRTFKSIPMSWSIFGKGEI
NT seq 606 nt   +upstreamnt  +downstreamnt
atgatcctaaagaatgatgatgtgtttcatttcaaagaagagcctatcccttcacccaag
atgtttacagtcaacacactaggtcctaaggggacaagcagtgaatacgcagcaaaacat
ttcatctctcaatccaccactacactcggcactcatacgaaactatccctttatgacaca
ttcgaaacttgcattgaacatactctctctcaaccacttcaatttactctcgttccacac
gcatatgaaggcatcaaacacttctacatgagaccagatctacagcttttacaaattttc
agatgtgacacgcccatgtatggtttggctgtcagacctgatttcccattcaatgaacaa
atgctccaccatttaaaaattgtctcacatcctgcacctgtcaatttaattcaatatttc
attcaccaaaatgctgaatttgaacttgttaattctacaagtactgccgcgcagaaagta
agggacggcgaatttgattttgctttaacgaatgaggtggcaagagccacatatggcctc
atcttcattcgaacgtttaaaagtatacccatgagttggtccatattcggaaaaggagag
atataa

DBGET integrated database retrieval system